BLASTX nr result
ID: Forsythia21_contig00024182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00024182 (206 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18635.1| unnamed protein product [Coffea canephora] 57 5e-06 >emb|CDP18635.1| unnamed protein product [Coffea canephora] Length = 80 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 100 MAAKYVLSSIVGTVAITYVCDNLIADQKVFGGTTP 204 M+AKY+LS +VG+ AI YVCD+LIAD+K+FGG TP Sbjct: 1 MSAKYILSGLVGSFAIAYVCDHLIADKKIFGGKTP 35