BLASTX nr result
ID: Forsythia21_contig00021638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00021638 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ85130.1| eEF1-gamma domain-containing protein [Aureobasidi... 107 4e-21 gb|KEQ75846.1| eEF1-gamma domain-containing protein [Aureobasidi... 105 1e-20 gb|KEQ58308.1| eEF1-gamma domain-containing protein [Aureobasidi... 105 2e-20 gb|KEQ93378.1| hypothetical protein AUEXF2481DRAFT_42115 [Aureob... 103 4e-20 ref|XP_007680497.1| hypothetical protein BAUCODRAFT_78172 [Baudo... 84 4e-14 ref|XP_007777470.1| elongation factor EF-1 gamma subunit [Conios... 81 2e-13 ref|XP_007296138.1| 40S ribosomal protein S3aE [Marssonina brunn... 79 9e-13 gb|KFH41350.1| Elongation factor 1-gamma-like protein [Acremoniu... 79 1e-12 gb|EUN29355.1| hypothetical protein COCVIDRAFT_24648 [Bipolaris ... 78 2e-12 ref|XP_007692467.1| hypothetical protein COCMIDRAFT_107326 [Bipo... 78 2e-12 ref|XP_007707915.1| hypothetical protein COCCADRAFT_1433 [Bipola... 78 2e-12 ref|XP_001793018.1| hypothetical protein SNOG_02412 [Phaeosphaer... 78 2e-12 ref|XP_007837708.1| hypothetical protein PFICI_10936 [Pestalotio... 78 3e-12 gb|EME47050.1| hypothetical protein DOTSEDRAFT_69132 [Dothistrom... 78 3e-12 gb|ENI01501.1| hypothetical protein COCC4DRAFT_43377 [Bipolaris ... 77 4e-12 gb|EMD94788.1| hypothetical protein COCHEDRAFT_1128600 [Bipolari... 77 4e-12 emb|CCE30045.1| probable translation elongation factor eEF-1,gam... 77 4e-12 ref|XP_008600479.1| elongation factor 1-gamma [Beauveria bassian... 77 4e-12 ref|XP_007705773.1| hypothetical protein COCSADRAFT_185747 [Bipo... 77 6e-12 ref|XP_001940726.1| elongation factor 1 gamma domain-containing ... 77 6e-12 >gb|KEQ85130.1| eEF1-gamma domain-containing protein [Aureobasidium pullulans EXF-150] Length = 414 Score = 107 bits (266), Expect = 4e-21 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPNQ 136 GIISRGF+YFFDKEWRSNNPNVTRWF TV+NQSIYSDVAEKLEFIEKAIPNQ Sbjct: 166 GIISRGFQYFFDKEWRSNNPNVTRWFETVTNQSIYSDVAEKLEFIEKAIPNQ 217 >gb|KEQ75846.1| eEF1-gamma domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 414 Score = 105 bits (262), Expect = 1e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 GIISRGF+YFFDKEWRSNNPNVTRWF TV+NQSIYSDVAEKLEFIEKAIPN Sbjct: 166 GIISRGFQYFFDKEWRSNNPNVTRWFTTVTNQSIYSDVAEKLEFIEKAIPN 216 >gb|KEQ58308.1| eEF1-gamma domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 410 Score = 105 bits (261), Expect = 2e-20 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 GIISRGF+YFFDKEWRSNNPNVTRWF TV+NQSIYSDVAEKLEFIEKAIPN Sbjct: 166 GIISRGFQYFFDKEWRSNNPNVTRWFETVTNQSIYSDVAEKLEFIEKAIPN 216 >gb|KEQ93378.1| hypothetical protein AUEXF2481DRAFT_42115 [Aureobasidium subglaciale EXF-2481] Length = 413 Score = 103 bits (257), Expect = 4e-20 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPNQ 136 GIISRGF++FFDKEWRS+NPNVTRWF TV+NQSIYSDVAEKLEFIEKAIPNQ Sbjct: 166 GIISRGFQFFFDKEWRSSNPNVTRWFETVTNQSIYSDVAEKLEFIEKAIPNQ 217 >ref|XP_007680497.1| hypothetical protein BAUCODRAFT_78172 [Baudoinia compniacensis UAMH 10762] gi|449296291|gb|EMC92311.1| hypothetical protein BAUCODRAFT_78172 [Baudoinia compniacensis UAMH 10762] Length = 422 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPNQ 136 IISRGF++FFDKEWR +P VTRW+ TV NQ IYS VA KLEFIE AIPNQ Sbjct: 167 IISRGFQFFFDKEWRKAHPGVTRWYETVYNQDIYSSVASKLEFIETAIPNQ 217 >ref|XP_007777470.1| elongation factor EF-1 gamma subunit [Coniosporium apollinis CBS 100218] gi|494824935|gb|EON62153.1| elongation factor EF-1 gamma subunit [Coniosporium apollinis CBS 100218] Length = 418 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 IISRGF++FFDK+WR NPNVTRW+ TV NQ IYS VA+KLEFI +AI N Sbjct: 166 IISRGFQFFFDKKWREENPNVTRWYETVYNQEIYSAVADKLEFINEAIKN 215 >ref|XP_007296138.1| 40S ribosomal protein S3aE [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860473|gb|EKD13531.1| 40S ribosomal protein S3aE [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 416 Score = 79.3 bits (194), Expect = 9e-13 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPNQ 136 G+ISRGF+YFFDK++RS NPN+TRW+ TV NQ IYS V ++L FI++AI NQ Sbjct: 166 GVISRGFQYFFDKKFRSENPNITRWYETVYNQPIYSAVVDELSFIDEAIKNQ 217 >gb|KFH41350.1| Elongation factor 1-gamma-like protein [Acremonium chrysogenum ATCC 11550] Length = 409 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEK 151 GII+RGF+YFFDK+WR NPNVTRW+ TV NQ IYS VAE LEF++K Sbjct: 165 GIITRGFQYFFDKKWRQENPNVTRWYETVINQPIYSAVAEPLEFLDK 211 >gb|EUN29355.1| hypothetical protein COCVIDRAFT_24648 [Bipolaris victoriae FI3] Length = 1009 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 II+RGF+YFFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IIARGFQYFFDKQWRDSNPNVTRWYETVYNQASYSAVAPKLEFITEALKN 215 >ref|XP_007692467.1| hypothetical protein COCMIDRAFT_107326 [Bipolaris oryzae ATCC 44560] gi|576927309|gb|EUC41002.1| hypothetical protein COCMIDRAFT_107326 [Bipolaris oryzae ATCC 44560] Length = 1014 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 II+RGF+YFFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IIARGFQYFFDKQWRDSNPNVTRWYETVYNQASYSAVAPKLEFIAEALKN 215 >ref|XP_007707915.1| hypothetical protein COCCADRAFT_1433 [Bipolaris zeicola 26-R-13] gi|576923662|gb|EUC37778.1| hypothetical protein COCCADRAFT_1433 [Bipolaris zeicola 26-R-13] Length = 1009 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 II+RGF+YFFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IIARGFQYFFDKQWRDSNPNVTRWYETVYNQASYSAVAPKLEFITEALKN 215 >ref|XP_001793018.1| hypothetical protein SNOG_02412 [Phaeosphaeria nodorum SN15] gi|111069504|gb|EAT90624.1| hypothetical protein SNOG_02412 [Phaeosphaeria nodorum SN15] Length = 414 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 II+RGF+YFFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IIARGFQYFFDKQWRDSNPNVTRWYETVCNQASYSAVAGKLEFITEALKN 215 >ref|XP_007837708.1| hypothetical protein PFICI_10936 [Pestalotiopsis fici W106-1] gi|573057187|gb|ETS77062.1| hypothetical protein PFICI_10936 [Pestalotiopsis fici W106-1] Length = 411 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEK 151 GIISRGF++FFDKEWR+ NPNV+RW+ TV NQ IYSDVA E +EK Sbjct: 164 GIISRGFQFFFDKEWRAKNPNVSRWYETVYNQKIYSDVAHPFELLEK 210 >gb|EME47050.1| hypothetical protein DOTSEDRAFT_69132 [Dothistroma septosporum NZE10] Length = 415 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIP 142 II RG++YFFDK WR+ NP VTRWF TV+NQ IY VA +L+FIEKAIP Sbjct: 166 IIGRGYQYFFDKAWRAENPTVTRWFETVANQDIYKAVAGELKFIEKAIP 214 >gb|ENI01501.1| hypothetical protein COCC4DRAFT_43377 [Bipolaris maydis ATCC 48331] Length = 1010 Score = 77.0 bits (188), Expect = 4e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 I++RGF+YFFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IMARGFQYFFDKQWRDSNPNVTRWYETVYNQASYSAVAPKLEFITEALKN 215 >gb|EMD94788.1| hypothetical protein COCHEDRAFT_1128600 [Bipolaris maydis C5] Length = 413 Score = 77.0 bits (188), Expect = 4e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 I++RGF+YFFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IMARGFQYFFDKQWRDSNPNVTRWYETVYNQASYSAVAPKLEFITEALKN 215 >emb|CCE30045.1| probable translation elongation factor eEF-1,gamma chain [Claviceps purpurea 20.1] Length = 411 Score = 77.0 bits (188), Expect = 4e-12 Identities = 30/46 (65%), Positives = 42/46 (91%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEK 151 +++RGF+YFFDKEWR+ NPNV+RW+ TV NQ IY+DVA+K++F+EK Sbjct: 165 LLNRGFQYFFDKEWRNQNPNVSRWYETVVNQPIYTDVAKKVDFLEK 210 >ref|XP_008600479.1| elongation factor 1-gamma [Beauveria bassiana ARSEF 2860] gi|400596052|gb|EJP63836.1| elongation factor 1-gamma [Beauveria bassiana ARSEF 2860] Length = 408 Score = 77.0 bits (188), Expect = 4e-12 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = -2 Query: 291 GIISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 GIISRGF+YF+D EWR +P TRW+ T+ NQ IYSD+ K++FI+KA+PN Sbjct: 165 GIISRGFDYFYDAEWRQAHPATTRWYETIVNQPIYSDIVGKVQFIDKALPN 215 >ref|XP_007705773.1| hypothetical protein COCSADRAFT_185747 [Bipolaris sorokiniana ND90Pr] gi|451845420|gb|EMD58733.1| hypothetical protein COCSADRAFT_185747 [Bipolaris sorokiniana ND90Pr] Length = 1009 Score = 76.6 bits (187), Expect = 6e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 II+RGF++FFDK+WR +NPNVTRW+ TV NQ+ YS VA KLEFI +A+ N Sbjct: 166 IIARGFQFFFDKQWRDSNPNVTRWYETVYNQASYSAVAPKLEFITEALKN 215 >ref|XP_001940726.1| elongation factor 1 gamma domain-containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976819|gb|EDU43445.1| elongation factor 1-gamma 1 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 382 Score = 76.6 bits (187), Expect = 6e-12 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -2 Query: 288 IISRGFEYFFDKEWRSNNPNVTRWFATVSNQSIYSDVAEKLEFIEKAIPN 139 I++RGF+YFFDK+WR +NPNVTRW+ T+ NQS YS VA K EFI +A+ N Sbjct: 135 ILARGFQYFFDKQWRDSNPNVTRWYETIYNQSSYSAVAPKFEFITEALKN 184