BLASTX nr result
ID: Forsythia21_contig00021601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00021601 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007674323.1| hypothetical protein BAUCODRAFT_23271 [Baudo... 64 5e-08 >ref|XP_007674323.1| hypothetical protein BAUCODRAFT_23271 [Baudoinia compniacensis UAMH 10762] gi|449302510|gb|EMC98519.1| hypothetical protein BAUCODRAFT_23271 [Baudoinia compniacensis UAMH 10762] Length = 621 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/71 (45%), Positives = 41/71 (57%) Frame = -2 Query: 215 TSKPSGTEGDSQPKADDANKKSSGNEEPEERMPRSGSTSTEGVQGKGQMSNESEGQNQGS 36 T +P+G EG PK DANKKS +E E + G ++T G Q KG + +S G Sbjct: 227 TDQPAGVEGQGMPKTSDANKKSEPDEGSEPK--EGGPSNTGGAQFKGGVREDSPGSGDER 284 Query: 35 KREPDGKGAFK 3 KREPD KGA+K Sbjct: 285 KREPDSKGAYK 295