BLASTX nr result
ID: Forsythia21_contig00021446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00021446 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutesce... 66 1e-08 ref|XP_011082260.1| PREDICTED: vetispiradiene synthase 3-like [S... 65 1e-08 gb|AGN72806.1| germacrene A [Lavandula viridis] 65 1e-08 gb|AGN72803.1| germacrene A [Lavandula stoechas] 65 1e-08 gb|AGN72800.1| germacrene A [Lavandula pedunculata subsp. lusita... 65 1e-08 gb|AAX16077.1| valencene synthase [Perilla frutescens var. frute... 65 2e-08 ref|XP_011073749.1| PREDICTED: vetispiradiene synthase 3-like [S... 64 3e-08 ref|XP_009589984.1| PREDICTED: 5-epi-aristolochene synthase-like... 63 7e-08 ref|XP_012843205.1| PREDICTED: LOW QUALITY PROTEIN: vetispiradie... 63 9e-08 ref|XP_012842919.1| PREDICTED: vetispiradiene synthase 3-like [E... 63 9e-08 gb|EYU32628.1| hypothetical protein MIMGU_mgv1a005108mg [Erythra... 63 9e-08 ref|XP_006367961.1| PREDICTED: viridiflorene synthase-like [Sola... 62 1e-07 sp|Q49SP5.1|TPGAS_POGCB RecName: Full=Germacrene A synthase; Alt... 62 2e-07 ref|XP_009757910.1| PREDICTED: 5-epi-aristolochene synthase 1-li... 61 3e-07 ref|XP_009779916.1| PREDICTED: 5-epi-aristolochene synthase, par... 61 3e-07 pdb|5EAU|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ... 61 3e-07 pdb|5EAT|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ... 61 3e-07 pdb|5EAS|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ... 61 3e-07 ref|XP_009771989.1| PREDICTED: 5-epi-aristolochene synthase-like... 61 3e-07 ref|XP_009762842.1| PREDICTED: 5-epi-aristolochene synthase-like... 61 3e-07 >gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutescens var. frutescens] Length = 550 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHK+EL++VSRWWKELDL++KLPYARDRV Sbjct: 235 NLLQMLHKEELHQVSRWWKELDLIAKLPYARDRV 268 >ref|XP_011082260.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum] Length = 554 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHK+ELY+VSRWWKELDL+SKL YARDRV Sbjct: 240 NLLQMLHKKELYEVSRWWKELDLISKLSYARDRV 273 >gb|AGN72806.1| germacrene A [Lavandula viridis] Length = 543 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQM+HK+EL++VSRWWKELDLV+KLPYARDRV Sbjct: 229 NLLQMMHKEELHEVSRWWKELDLVAKLPYARDRV 262 >gb|AGN72803.1| germacrene A [Lavandula stoechas] Length = 542 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQM+HK+EL++VSRWWKELDLV+KLPYARDRV Sbjct: 228 NLLQMMHKEELHEVSRWWKELDLVAKLPYARDRV 261 >gb|AGN72800.1| germacrene A [Lavandula pedunculata subsp. lusitanica] Length = 547 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQM+HK+EL++VSRWWKELDLV+KLPYARDRV Sbjct: 233 NLLQMMHKEELHEVSRWWKELDLVAKLPYARDRV 266 >gb|AAX16077.1| valencene synthase [Perilla frutescens var. frutescens] Length = 550 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHK+EL++VSRWWK+LDL++KLPYARDRV Sbjct: 235 NLLQMLHKEELHQVSRWWKDLDLITKLPYARDRV 268 >ref|XP_011073749.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum] Length = 554 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDR 4 N LQMLHK+EL+++SRWWKELDLV+KLPYARDR Sbjct: 240 NLLQMLHKEELHEISRWWKELDLVAKLPYARDR 272 >ref|XP_009589984.1| PREDICTED: 5-epi-aristolochene synthase-like, partial [Nicotiana tomentosiformis] Length = 286 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+KLPYARDRV Sbjct: 203 NLLQMLHKQELAEVSRWWKDLDFVTKLPYARDRV 236 >ref|XP_012843205.1| PREDICTED: LOW QUALITY PROTEIN: vetispiradiene synthase 3-like, partial [Erythranthe guttatus] Length = 516 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQ LHK EL +VSRWWKELDLVSKLPYARDRV Sbjct: 202 NLLQTLHKDELREVSRWWKELDLVSKLPYARDRV 235 >ref|XP_012842919.1| PREDICTED: vetispiradiene synthase 3-like [Erythranthe guttatus] gi|604322243|gb|EYU32629.1| hypothetical protein MIMGU_mgv1a023948mg [Erythranthe guttata] Length = 549 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQML+K EL +VSRWWKELDLVSKLPYARDRV Sbjct: 235 NLLQMLYKDELREVSRWWKELDLVSKLPYARDRV 268 >gb|EYU32628.1| hypothetical protein MIMGU_mgv1a005108mg [Erythranthe guttata] Length = 496 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQ LHK EL +VSRWWKELDLVSKLPYARDRV Sbjct: 182 NLLQTLHKDELREVSRWWKELDLVSKLPYARDRV 215 >ref|XP_006367961.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum] Length = 560 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWKELD V+ LPYARDRV Sbjct: 245 NLLQMLHKQELAEVSRWWKELDFVTTLPYARDRV 278 >sp|Q49SP5.1|TPGAS_POGCB RecName: Full=Germacrene A synthase; AltName: Full=PatTpsCF2 [Pogostemon cablin] gi|46254779|gb|AAS86321.1| germacrene A synthase [Pogostemon cablin] Length = 554 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N+LQ LHK+EL ++S+WWK+LDL+SKLPYARDRV Sbjct: 239 NALQALHKEELSEISKWWKDLDLISKLPYARDRV 272 >ref|XP_009757910.1| PREDICTED: 5-epi-aristolochene synthase 1-like [Nicotiana sylvestris] Length = 452 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 257 NMLQMLHKQELAEVSRWWKDLDFVTTLPYARDRV 290 >ref|XP_009779916.1| PREDICTED: 5-epi-aristolochene synthase, partial [Nicotiana sylvestris] Length = 540 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 226 NMLQMLHKQELAEVSRWWKDLDFVTTLPYARDRV 259 >pdb|5EAU|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum Length = 548 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 234 NLLQMLHKQELAQVSRWWKDLDFVTTLPYARDRV 267 >pdb|5EAT|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum With Substrate Analog Farnesyl Hydroxyphosphonate Length = 548 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 234 NLLQMLHKQELAQVSRWWKDLDFVTTLPYARDRV 267 >pdb|5EAS|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum Length = 548 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 234 NLLQMLHKQELAQVSRWWKDLDFVTTLPYARDRV 267 >ref|XP_009771989.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana sylvestris] Length = 548 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 234 NLLQMLHKQELAEVSRWWKDLDFVTTLPYARDRV 267 >ref|XP_009762842.1| PREDICTED: 5-epi-aristolochene synthase-like isoform X2 [Nicotiana sylvestris] Length = 466 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 NSLQMLHKQELYKVSRWWKELDLVSKLPYARDRV 1 N LQMLHKQEL +VSRWWK+LD V+ LPYARDRV Sbjct: 234 NLLQMLHKQELAEVSRWWKDLDFVTTLPYARDRV 267