BLASTX nr result
ID: Forsythia21_contig00021356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00021356 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQL04090.1| Ribosomal protein S4/S9 [Ophiocordyceps sinensis ... 149 5e-34 gb|KLU90799.1| 40S ribosomal protein S9 [Magnaporthiopsis poae A... 149 9e-34 gb|KKY29928.1| putative 40s ribosomal protein s9 [Diaporthe ampe... 149 9e-34 gb|KKY19729.1| putative 40s ribosomal protein s9 [Phaeomoniella ... 149 9e-34 gb|KKF96374.1| 40S ribosomal protein S9 [Ceratocystis platani] 149 9e-34 gb|KIW50177.1| 40S ribosomal protein S9 [Exophiala xenobiotica] 149 9e-34 gb|KEZ42817.1| hypothetical protein SAPIO_CDS5234 [Scedosporium ... 149 9e-34 gb|KDN65245.1| putative ribosomal protein S4 [Colletotrichum sub... 149 9e-34 ref|XP_003007794.1| 40S ribosomal protein S9 [Verticillium alfal... 149 9e-34 ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fio... 149 9e-34 ref|XP_007829664.1| 40S ribosomal protein S9 [Pestalotiopsis fic... 149 9e-34 ref|XP_007913411.1| putative 40s ribosomal protein s9 protein [T... 149 9e-34 ref|XP_007788827.1| putative 40s ribosomal protein s9 protein [E... 149 9e-34 ref|XP_007922661.1| hypothetical protein MYCFIDRAFT_60241 [Pseud... 149 9e-34 ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeos... 149 9e-34 ref|XP_009220754.1| 40S ribosomal protein S9 [Gaeumannomyces gra... 149 9e-34 emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higgins... 149 9e-34 ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria triti... 149 9e-34 ref|XP_008093522.1| ribosomal protein S4 [Colletotrichum gramini... 149 9e-34 gb|KJZ79329.1| 40S ribosomal protein S9 [Hirsutella minnesotensi... 148 1e-33 >gb|EQL04090.1| Ribosomal protein S4/S9 [Ophiocordyceps sinensis CO18] Length = 191 Score = 149 bits (377), Expect = 5e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDEARMKLDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDEARMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KLU90799.1| 40S ribosomal protein S9 [Magnaporthiopsis poae ATCC 64411] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KKY29928.1| putative 40s ribosomal protein s9 [Diaporthe ampelina] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KKY19729.1| putative 40s ribosomal protein s9 [Phaeomoniella chlamydospora] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 75/78 (96%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLI+QRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSF+VRLDS Sbjct: 133 RVGKQIVNVPSFVVRLDS 150 >gb|KKF96374.1| 40S ribosomal protein S9 [Ceratocystis platani] Length = 189 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KIW50177.1| 40S ribosomal protein S9 [Exophiala xenobiotica] Length = 193 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KEZ42817.1| hypothetical protein SAPIO_CDS5234 [Scedosporium apiospermum] Length = 190 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KDN65245.1| putative ribosomal protein S4 [Colletotrichum sublineola] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_003007794.1| 40S ribosomal protein S9 [Verticillium alfalfae VaMs.102] gi|697073415|ref|XP_009651388.1| 40S ribosomal protein S9 [Verticillium dahliae VdLs.17] gi|261353445|gb|EEY15873.1| 40S ribosomal protein S9 [Verticillium alfalfae VaMs.102] gi|346977464|gb|EGY20916.1| 40S ribosomal protein S9 [Verticillium dahliae VdLs.17] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] gi|588902324|gb|EXF82658.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] Length = 192 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_007829664.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1] gi|573065265|gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1] Length = 190 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_007913411.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7] gi|500258965|gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_007788827.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1] gi|471574134|gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_007922661.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis CIRAD86] gi|452985605|gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis CIRAD86] Length = 193 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|429862840|gb|ELA37447.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|530474861|gb|EQB55027.1| hypothetical protein CGLO_05076 [Colletotrichum gloeosporioides Cg-14] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_009220754.1| 40S ribosomal protein S9 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402084591|gb|EJT79609.1| 40S ribosomal protein S9 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 192 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 74 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 133 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 134 RVGKQIVNVPSFIVRLDS 151 >emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higginsianum] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria tritici IPO323] gi|339467586|gb|EGP82689.1| hypothetical protein MYCGRDRAFT_106533 [Zymoseptoria tritici IPO323] gi|796707985|gb|KJX99191.1| 40s ribosomal protein s9 [Zymoseptoria brevis] Length = 194 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >ref|XP_008093522.1| ribosomal protein S4 [Colletotrichum graminicola M1.001] gi|310794041|gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola M1.001] gi|477525810|gb|ENH77682.1| 40s ribosomal protein [Colletotrichum orbiculare MAFF 240422] Length = 191 Score = 149 bits (375), Expect = 9e-34 Identities = 76/78 (97%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150 >gb|KJZ79329.1| 40S ribosomal protein S9 [Hirsutella minnesotensis 3608] Length = 191 Score = 148 bits (374), Expect = 1e-33 Identities = 75/78 (96%), Positives = 78/78 (100%) Frame = +3 Query: 3 ALIRRLVRVGVLDEARMKLDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 182 ALIRRLVRVGVLDE+RMKLDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI Sbjct: 73 ALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHI 132 Query: 183 RVGKQIVNVPSFIVRLDS 236 RVGKQIVNVPSFIVRLDS Sbjct: 133 RVGKQIVNVPSFIVRLDS 150