BLASTX nr result
ID: Forsythia21_contig00021224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00021224 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ68289.1| HSP20-like chaperone [Aureobasidium namibiae CBS ... 57 6e-06 >gb|KEQ68289.1| HSP20-like chaperone [Aureobasidium namibiae CBS 147.97] Length = 254 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/65 (47%), Positives = 37/65 (56%) Frame = +2 Query: 29 MQIYRLSNSTPQVYRINKIIPTNITTRNMAFYPRFFAHEFAPSLRGESTNLFRLLDDYAG 208 MQ YR++N PQ Y+I K+ P R M +PRF + EFAP LFRLLDDYA Sbjct: 1 MQTYRITNKLPQAYKIIKVTPQATPVRTMFSFPRFPSGEFAP--------LFRLLDDYAS 52 Query: 209 LVSGR 223 S R Sbjct: 53 HQSSR 57