BLASTX nr result
ID: Forsythia21_contig00020760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00020760 (251 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 65 2e-08 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 246 MAWVMLKIDYSRLFWLLFGVFSYENHEGKPRI 151 + W+ML+IDYSRL WLLFGVFSYENHEGKPRI Sbjct: 29 ITWIMLRIDYSRLSWLLFGVFSYENHEGKPRI 60