BLASTX nr result
ID: Forsythia21_contig00020365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00020365 (473 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001934008.1| endoglucanase IV precursor [Pyrenophora trit... 63 7e-08 ref|XP_003303895.1| hypothetical protein PTT_16293 [Pyrenophora ... 62 1e-07 >ref|XP_001934008.1| endoglucanase IV precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979887|gb|EDU46513.1| endoglucanase IV precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 342 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 188 KEFTLDTFIAWLEEKAGSSSSQKVRRHPRAFR 93 KEFT+DTFI+WLEEKAG SSQKVRRHPRAFR Sbjct: 310 KEFTIDTFISWLEEKAGGKSSQKVRRHPRAFR 341 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 473 GTPANKLYTATDPGIKVNVYGGDMSSYEMPGPALF 369 GTPANKLYT TDPGIKV+VY GD S Y+MPGPALF Sbjct: 208 GTPANKLYTPTDPGIKVSVY-GDNSKYQMPGPALF 241 >ref|XP_003303895.1| hypothetical protein PTT_16293 [Pyrenophora teres f. teres 0-1] gi|311319793|gb|EFQ88002.1| hypothetical protein PTT_16293 [Pyrenophora teres f. teres 0-1] Length = 347 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 188 KEFTLDTFIAWLEEKAGSSSSQKVRRHPRAFR 93 K+FT+DTFI+WLEEKAG+ SSQKVRRHPRAFR Sbjct: 315 KQFTVDTFISWLEEKAGAKSSQKVRRHPRAFR 346 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 473 GTPANKLYTATDPGIKVNVYGGDMSSYEMPGPALF 369 GTPANKLYT TDPGIKV+VY GD S Y+MPGPALF Sbjct: 208 GTPANKLYTPTDPGIKVSVY-GDNSKYQMPGPALF 241