BLASTX nr result
ID: Forsythia21_contig00020071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00020071 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB20918.1| hypothetical protein B456_003G177300 [Gossypium r... 113 4e-23 ref|XP_012472091.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 113 4e-23 gb|KHG18581.1| hypothetical protein F383_08798 [Gossypium arboreum] 113 4e-23 ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 113 6e-23 ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 113 6e-23 ref|XP_011047578.1| PREDICTED: 50S ribosomal protein L19, chloro... 112 7e-23 ref|XP_009781001.1| PREDICTED: 50S ribosomal protein L19, chloro... 112 7e-23 ref|XP_009621255.1| PREDICTED: 50S ribosomal protein L19, chloro... 112 7e-23 ref|XP_006368958.1| ribosomal protein L19 [Populus trichocarpa] ... 112 7e-23 ref|XP_010053530.1| PREDICTED: 50S ribosomal protein L19, chloro... 112 1e-22 ref|XP_009413275.1| PREDICTED: 50S ribosomal protein L19, chloro... 112 1e-22 ref|XP_007039708.1| Ribosomal protein L19 family protein [Theobr... 112 1e-22 ref|XP_010275481.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 111 2e-22 ref|XP_010275480.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 111 2e-22 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19-2, chlo... 111 2e-22 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 111 2e-22 dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] 111 2e-22 ref|XP_010494948.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 111 2e-22 ref|XP_010481350.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 111 2e-22 ref|XP_010441489.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 111 2e-22 >gb|KJB20918.1| hypothetical protein B456_003G177300 [Gossypium raimondii] Length = 215 Score = 113 bits (283), Expect = 4e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 159 IHTTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 215 >ref|XP_012472091.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Gossypium raimondii] gi|763753527|gb|KJB20915.1| hypothetical protein B456_003G177300 [Gossypium raimondii] Length = 241 Score = 113 bits (283), Expect = 4e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 185 IHTTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 241 >gb|KHG18581.1| hypothetical protein F383_08798 [Gossypium arboreum] Length = 228 Score = 113 bits (283), Expect = 4e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 172 IHTTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 228 >ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Solanum tuberosum] Length = 222 Score = 113 bits (282), Expect = 6e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAGVGVEIVFPVYSPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 166 IHTTIRIRRIIAGVGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 222 >ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Solanum lycopersicum] Length = 214 Score = 113 bits (282), Expect = 6e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAGVGVEIVFPVYSPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 158 IHTTIRIRRIIAGVGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 214 >ref|XP_011047578.1| PREDICTED: 50S ribosomal protein L19, chloroplastic [Populus euphratica] gi|743940605|ref|XP_011014778.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Populus euphratica] Length = 241 Score = 112 bits (281), Expect = 7e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK Sbjct: 185 IHTTIRIRRIIAGIGVEIVFPLYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 241 >ref|XP_009781001.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Nicotiana sylvestris] Length = 216 Score = 112 bits (281), Expect = 7e-23 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 160 IHTTIRIRRIIAGIGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 216 >ref|XP_009621255.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Nicotiana tomentosiformis] Length = 216 Score = 112 bits (281), Expect = 7e-23 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 160 IHTTIRIRRIIAGIGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 216 >ref|XP_006368958.1| ribosomal protein L19 [Populus trichocarpa] gi|118483873|gb|ABK93827.1| unknown [Populus trichocarpa] gi|550347317|gb|ERP65527.1| ribosomal protein L19 [Populus trichocarpa] Length = 241 Score = 112 bits (281), Expect = 7e-23 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK Sbjct: 185 IHTTIRIRRIIAGIGVEIVFPLYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 241 >ref|XP_010053530.1| PREDICTED: 50S ribosomal protein L19, chloroplastic [Eucalyptus grandis] gi|629112888|gb|KCW77848.1| hypothetical protein EUGRSUZ_D02125 [Eucalyptus grandis] Length = 244 Score = 112 bits (280), Expect = 1e-22 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 188 IHTTIRIRRIIAGIGVEIVFPLYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 244 >ref|XP_009413275.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 226 Score = 112 bits (279), Expect = 1e-22 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAGVGVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 170 IHTTIRIRRIIAGVGVEIVFPVYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 226 >ref|XP_007039708.1| Ribosomal protein L19 family protein [Theobroma cacao] gi|508776953|gb|EOY24209.1| Ribosomal protein L19 family protein [Theobroma cacao] Length = 242 Score = 112 bits (279), Expect = 1e-22 Identities = 53/57 (92%), Positives = 57/57 (100%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+KHRKVRRARLYYLR+KLPRLSTFK Sbjct: 186 IHTTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVKHRKVRRARLYYLREKLPRLSTFK 242 >ref|XP_010275481.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic isoform X2 [Nelumbo nucifera] Length = 237 Score = 111 bits (278), Expect = 2e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 181 IHTTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 237 >ref|XP_010275480.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic isoform X1 [Nelumbo nucifera] Length = 241 Score = 111 bits (278), Expect = 2e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 185 IHTTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 241 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19-2, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 111 bits (278), Expect = 2e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIR+RR+IAGVGVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 175 IHTTIRVRRIIAGVGVEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 111 bits (278), Expect = 2e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIR+RR+IAGVGVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 175 IHTTIRVRRIIAGVGVEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] Length = 286 Score = 111 bits (277), Expect = 2e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 230 IHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 286 >ref|XP_010494948.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Camelina sativa] Length = 228 Score = 111 bits (277), Expect = 2e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 172 IHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 228 >ref|XP_010481350.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic [Camelina sativa] Length = 228 Score = 111 bits (277), Expect = 2e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 172 IHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 228 >ref|XP_010441489.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Camelina sativa] Length = 229 Score = 111 bits (277), Expect = 2e-22 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 216 IHTTIRIRRVIAGVGVEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 46 IHTTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 173 IHTTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229