BLASTX nr result
ID: Forsythia21_contig00019466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00019466 (226 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008793782.1| PREDICTED: 60S ribosomal protein L38 [Phoeni... 64 3e-08 emb|CDP04642.1| unnamed protein product [Coffea canephora] 64 3e-08 emb|CDP18171.1| unnamed protein product [Coffea canephora] 64 3e-08 gb|KDO45681.1| hypothetical protein CISIN_1g0352561mg, partial [... 64 3e-08 gb|KCW87739.1| hypothetical protein EUGRSUZ_A00108, partial [Euc... 64 3e-08 emb|CBI17596.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002514807.1| 60S ribosomal protein L38, putative [Ricinus... 64 3e-08 ref|XP_002533843.1| 60S ribosomal protein L38, putative [Ricinus... 64 3e-08 ref|XP_006428680.1| hypothetical protein CICLE_v10013279mg [Citr... 64 3e-08 ref|XP_007224245.1| hypothetical protein PRUPE_ppa019382mg, part... 64 3e-08 ref|XP_007207316.1| hypothetical protein PRUPE_ppa014434mg [Prun... 64 3e-08 ref|XP_003631881.1| PREDICTED: 60S ribosomal protein L38 [Vitis ... 64 3e-08 ref|XP_012834519.1| PREDICTED: uncharacterized protein LOC105955... 63 7e-08 ref|XP_002272496.2| PREDICTED: 60S ribosomal protein L38 [Vitis ... 63 7e-08 ref|XP_009361584.1| PREDICTED: 60S ribosomal protein L38-like [P... 63 7e-08 ref|XP_012085801.1| PREDICTED: 60S ribosomal protein L38 [Jatrop... 63 7e-08 emb|CBI36730.3| unnamed protein product [Vitis vinifera] 63 7e-08 gb|EYU39732.1| hypothetical protein MIMGU_mgv1a016440mg [Erythra... 63 7e-08 ref|XP_006595070.1| PREDICTED: 60S ribosomal protein L38 isoform... 63 7e-08 ref|XP_004302190.1| PREDICTED: 60S ribosomal protein L38 [Fragar... 63 7e-08 >ref|XP_008793782.1| PREDICTED: 60S ribosomal protein L38 [Phoenix dactylifera] Length = 69 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >emb|CDP04642.1| unnamed protein product [Coffea canephora] Length = 104 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 75 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 104 >emb|CDP18171.1| unnamed protein product [Coffea canephora] Length = 104 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 75 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 104 >gb|KDO45681.1| hypothetical protein CISIN_1g0352561mg, partial [Citrus sinensis] Length = 68 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 39 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 68 >gb|KCW87739.1| hypothetical protein EUGRSUZ_A00108, partial [Eucalyptus grandis] Length = 100 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 71 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 100 >emb|CBI17596.3| unnamed protein product [Vitis vinifera] Length = 127 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 98 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 127 >ref|XP_002514807.1| 60S ribosomal protein L38, putative [Ricinus communis] gi|223545858|gb|EEF47361.1| 60S ribosomal protein L38, putative [Ricinus communis] Length = 78 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 49 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 78 >ref|XP_002533843.1| 60S ribosomal protein L38, putative [Ricinus communis] gi|223526222|gb|EEF28545.1| 60S ribosomal protein L38, putative [Ricinus communis] Length = 96 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 67 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 96 >ref|XP_006428680.1| hypothetical protein CICLE_v10013279mg [Citrus clementina] gi|567900956|ref|XP_006442966.1| hypothetical protein CICLE_v10023214mg [Citrus clementina] gi|567900958|ref|XP_006442967.1| hypothetical protein CICLE_v10023214mg [Citrus clementina] gi|568850070|ref|XP_006478751.1| PREDICTED: 60S ribosomal protein L38-like [Citrus sinensis] gi|568853725|ref|XP_006480494.1| PREDICTED: 60S ribosomal protein L38-like [Citrus sinensis] gi|778668106|ref|XP_011649040.1| PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] gi|557530737|gb|ESR41920.1| hypothetical protein CICLE_v10013279mg [Citrus clementina] gi|557545228|gb|ESR56206.1| hypothetical protein CICLE_v10023214mg [Citrus clementina] gi|557545229|gb|ESR56207.1| hypothetical protein CICLE_v10023214mg [Citrus clementina] gi|700206240|gb|KGN61359.1| hypothetical protein Csa_2G098440 [Cucumis sativus] Length = 69 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_007224245.1| hypothetical protein PRUPE_ppa019382mg, partial [Prunus persica] gi|462421181|gb|EMJ25444.1| hypothetical protein PRUPE_ppa019382mg, partial [Prunus persica] Length = 105 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 76 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 105 >ref|XP_007207316.1| hypothetical protein PRUPE_ppa014434mg [Prunus persica] gi|645223113|ref|XP_008218474.1| PREDICTED: 60S ribosomal protein L38 [Prunus mume] gi|645231724|ref|XP_008222531.1| PREDICTED: 60S ribosomal protein L38 [Prunus mume] gi|462402958|gb|EMJ08515.1| hypothetical protein PRUPE_ppa014434mg [Prunus persica] Length = 69 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_003631881.1| PREDICTED: 60S ribosomal protein L38 [Vitis vinifera] gi|449454586|ref|XP_004145035.1| PREDICTED: 60S ribosomal protein L38 [Cucumis sativus] gi|659082225|ref|XP_008441729.1| PREDICTED: 60S ribosomal protein L38 [Cucumis melo] gi|659120134|ref|XP_008460031.1| PREDICTED: 60S ribosomal protein L38 [Cucumis melo] gi|659120136|ref|XP_008460032.1| PREDICTED: 60S ribosomal protein L38 [Cucumis melo] gi|702236883|ref|XP_010047294.1| PREDICTED: 60S ribosomal protein L38 [Eucalyptus grandis] gi|702263487|ref|XP_010038403.1| PREDICTED: 60S ribosomal protein L38 [Eucalyptus grandis] gi|702487693|ref|XP_010034894.1| PREDICTED: 60S ribosomal protein L38 [Eucalyptus grandis] gi|720008027|ref|XP_010258506.1| PREDICTED: 60S ribosomal protein L38 [Nelumbo nucifera] gi|720082911|ref|XP_010242739.1| PREDICTED: 60S ribosomal protein L38 [Nelumbo nucifera] gi|731323124|ref|XP_010672261.1| PREDICTED: 60S ribosomal protein L38 [Beta vulgaris subsp. vulgaris] gi|731326173|ref|XP_010673886.1| PREDICTED: 60S ribosomal protein L38 [Beta vulgaris subsp. vulgaris] gi|769820507|ref|XP_011620720.1| PREDICTED: 60S ribosomal protein L38 [Amborella trichopoda] gi|778711423|ref|XP_011656729.1| PREDICTED: 60S ribosomal protein L38 [Cucumis sativus] gi|629079644|gb|KCW46089.1| hypothetical protein EUGRSUZ_K00006 [Eucalyptus grandis] gi|700191105|gb|KGN46309.1| hypothetical protein Csa_6G081500 [Cucumis sativus] gi|870863550|gb|KMT14714.1| hypothetical protein BVRB_4g074810 [Beta vulgaris subsp. vulgaris] gi|870864710|gb|KMT15805.1| hypothetical protein BVRB_3g057800 [Beta vulgaris subsp. vulgaris] Length = 69 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_012834519.1| PREDICTED: uncharacterized protein LOC105955349 [Erythranthe guttatus] Length = 169 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFD+EKADKLKQSLPPGLSVQDL Sbjct: 140 KYLYTLCVFDTEKADKLKQSLPPGLSVQDL 169 >ref|XP_002272496.2| PREDICTED: 60S ribosomal protein L38 [Vitis vinifera] Length = 128 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFD+EKADKLKQSLPPGLSVQDL Sbjct: 99 KYLYTLCVFDAEKADKLKQSLPPGLSVQDL 128 >ref|XP_009361584.1| PREDICTED: 60S ribosomal protein L38-like [Pyrus x bretschneideri] gi|694425247|ref|XP_009340368.1| PREDICTED: 60S ribosomal protein L38-like [Pyrus x bretschneideri] gi|694425259|ref|XP_009340374.1| PREDICTED: 60S ribosomal protein L38-like [Pyrus x bretschneideri] Length = 69 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGL+VQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLNVQDL 69 >ref|XP_012085801.1| PREDICTED: 60S ribosomal protein L38 [Jatropha curcas] gi|643714235|gb|KDP26900.1| hypothetical protein JCGZ_18058 [Jatropha curcas] Length = 69 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGL+VQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >emb|CBI36730.3| unnamed protein product [Vitis vinifera] Length = 96 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFD+EKADKLKQSLPPGLSVQDL Sbjct: 67 KYLYTLCVFDAEKADKLKQSLPPGLSVQDL 96 >gb|EYU39732.1| hypothetical protein MIMGU_mgv1a016440mg [Erythranthe guttata] Length = 122 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFD+EKADKLKQSLPPGLSVQDL Sbjct: 93 KYLYTLCVFDTEKADKLKQSLPPGLSVQDL 122 >ref|XP_006595070.1| PREDICTED: 60S ribosomal protein L38 isoform X2 [Glycine max] gi|571515197|ref|XP_006597216.1| PREDICTED: 60S ribosomal protein L38-like isoform X1 [Glycine max] Length = 70 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGLSVQD+ Sbjct: 41 KYLYTLCVFDSEKADKLKQSLPPGLSVQDV 70 >ref|XP_004302190.1| PREDICTED: 60S ribosomal protein L38 [Fragaria vesca subsp. vesca] Length = 69 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 224 KYLYTLCVFDSEKADKLKQSLPPGLSVQDL 135 KYLYTLCVFDSEKADKLKQSLPPGL+VQDL Sbjct: 40 KYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69