BLASTX nr result
ID: Forsythia21_contig00018962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018962 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 79 1e-12 gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium r... 65 2e-08 ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Popu... 63 9e-08 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 61 3e-07 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Popu... 60 8e-07 ref|XP_002527500.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 emb|CDY30820.1| BnaC05g21960D [Brassica napus] 57 6e-06 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 79.0 bits (193), Expect = 1e-12 Identities = 43/77 (55%), Positives = 51/77 (66%) Frame = +2 Query: 2 CNRAGH*SGANGGPCNLCSGV*ALYAGPPVPSRAVTRVVRAKAWVTPLLKRRAPREAGFT 181 C+ +G G ++ G+ L +GPPVPSR + VVRAKA T +LK RAPREAGFT Sbjct: 46 CDPSGGIKVVGRGLESIGPGLQRLLSGPPVPSRELIHVVRAKARATCVLKWRAPREAGFT 105 Query: 182 EQRKPPALDGGRITDRC 232 EQRKPPA GRIT RC Sbjct: 106 EQRKPPAPGSGRITGRC 122 >gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium raimondii] Length = 79 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 71 LYAGPPVPSRAVTRVVRAKAWVTPLLKRRAPREAGFTEQRKPPALDGGRITDRCAPHPLW 250 L +G VPS+ +++V AKAWV LL+ +APREAGFTEQRK P L GRIT C P W Sbjct: 8 LSSGLSVPSQELSQVSCAKAWVLWLLEWKAPREAGFTEQRKLPPLGSGRITGCCHLDPYW 67 >ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] gi|550305511|gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Frame = +2 Query: 56 SGV*ALYAGPPVPSRAVTRVVRAKAWVTPLLKRRAPREAGFTEQRKPPALDGGRITDRC- 232 SG +GPPVPS+ +++ + K WV+ LL+ RA REAG TEQR PA GRIT RC Sbjct: 5 SGSGCFLSGPPVPSQELSQGILVKTWVSWLLEGRAQREAGLTEQRSLPAPGSGRITGRCH 64 Query: 233 -APHPL 247 PH L Sbjct: 65 LDPHGL 70 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = +2 Query: 77 AGPPVPSRAVTRVVRAKAWVTPLLKRRAPREAGFTEQRKPPALDGGRITDRCAPHPLW 250 AG P PS ++ VV AK T LL+ R REAGFTEQR PPALD G IT C P W Sbjct: 9 AGLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSCHLIPAW 66 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = +1 Query: 73 LCWSARSKSGSDTCGPCESVGHASLEAEGTA*GWVHRAAKTSRSRRWKDNGPL 231 + W ARSK D CG E G AEGTA GW HRAA TS S +WKDNGP+ Sbjct: 1 MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPV 53 >ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] gi|550318586|gb|ERP49937.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] Length = 83 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = +2 Query: 56 SGV*ALYAGPPVPSRAVTRVVRAKAWVTPLLKRRAPREAGFTEQRKPPALDGGRITDRC 232 SG L + PPVPS+ +++ + K V+ LL+ RA REAG TEQR PPA GRIT RC Sbjct: 5 SGSGCLLSDPPVPSQELSQGILVKTLVSWLLEGRAQREAGLTEQRSPPAPGSGRITGRC 63 >ref|XP_002527500.1| conserved hypothetical protein [Ricinus communis] gi|223533140|gb|EEF34898.1| conserved hypothetical protein [Ricinus communis] Length = 61 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 80 GPPVPSRAVTRVVRAKAWVTPLLKRRAPREAGFTEQRKPPALD 208 G PVPS + RV RAKAW + L+ R PREAGFTE++KPP+L+ Sbjct: 10 GSPVPSWELNRVARAKAWASLFLEWREPREAGFTEEQKPPSLE 52 >emb|CDY30820.1| BnaC05g21960D [Brassica napus] Length = 55 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +2 Query: 140 PLLKRRAPREAGFTEQRKPPALDGGRITDRCAPHPL 247 P+ KRR REAGF EQR PPA DGGRIT RC P PL Sbjct: 20 PIPKRRRLREAGFREQRPPPAFDGGRITGRCLPSPL 55