BLASTX nr result
ID: Forsythia21_contig00018912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018912 (457 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098231.1| PREDICTED: TPR repeat-containing thioredoxin... 164 2e-38 ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 164 3e-38 ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin... 163 4e-38 ref|XP_011082756.1| PREDICTED: TPR repeat-containing thioredoxin... 162 8e-38 ref|XP_009604807.1| PREDICTED: TPR repeat-containing thioredoxin... 162 8e-38 ref|XP_009794169.1| PREDICTED: TPR repeat-containing thioredoxin... 162 1e-37 gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlise... 156 6e-36 emb|CDP06000.1| unnamed protein product [Coffea canephora] 154 2e-35 ref|XP_012850688.1| PREDICTED: TPR repeat-containing thioredoxin... 152 6e-35 gb|EYU26330.1| hypothetical protein MIMGU_mgv1a002333mg [Erythra... 152 6e-35 ref|XP_010277046.1| PREDICTED: TPR repeat-containing thioredoxin... 152 1e-34 ref|XP_012078581.1| PREDICTED: TPR repeat-containing thioredoxin... 151 1e-34 gb|KEH38622.1| TPR repeat thioredoxin TTL1-like protein [Medicag... 151 2e-34 ref|XP_011460778.1| PREDICTED: TPR repeat-containing thioredoxin... 150 2e-34 ref|XP_012457385.1| PREDICTED: TPR repeat-containing thioredoxin... 150 4e-34 ref|XP_012457374.1| PREDICTED: TPR repeat-containing thioredoxin... 150 4e-34 ref|XP_010279112.1| PREDICTED: TPR repeat-containing thioredoxin... 149 7e-34 ref|XP_004489036.1| PREDICTED: TPR repeat-containing thioredoxin... 148 1e-33 ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phas... 148 2e-33 ref|XP_011016487.1| PREDICTED: TPR repeat-containing thioredoxin... 147 2e-33 >ref|XP_011098231.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Sesamum indicum] Length = 696 Score = 164 bits (415), Expect = 2e-38 Identities = 80/95 (84%), Positives = 87/95 (91%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAISS ASVVHFKASSN QCKQIS FLDTLC+RYPS+NFLKVD++ESP IA AENV Sbjct: 602 QFRAAISSSGASVVHFKASSNAQCKQISPFLDTLCSRYPSINFLKVDIDESPAIAHAENV 661 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIYR GSRVKEM+CPS EVLESSVRHYSI Sbjct: 662 RIVPTFKIYRNGSRVKEMVCPSQEVLESSVRHYSI 696 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Solanum lycopersicum] Length = 701 Score = 164 bits (414), Expect = 3e-38 Identities = 81/95 (85%), Positives = 89/95 (93%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QF+AAISSP ASVVHFKA+SNLQCKQIS FLDTL +YPS+NFLKVDVEESP+IA AENV Sbjct: 607 QFQAAISSPCASVVHFKAASNLQCKQISPFLDTLTTKYPSINFLKVDVEESPSIANAENV 666 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+KGSRVKEMICPS EVLESSVRHYSI Sbjct: 667 RIVPTFKIYKKGSRVKEMICPSQEVLESSVRHYSI 701 >ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum tuberosum] Length = 700 Score = 163 bits (413), Expect = 4e-38 Identities = 81/95 (85%), Positives = 88/95 (92%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QF+AAISSP ASVVHFKA+SNLQCKQIS FLDTL +YPS+NFLKVDVEESP IA AENV Sbjct: 606 QFQAAISSPCASVVHFKAASNLQCKQISPFLDTLTTKYPSINFLKVDVEESPAIANAENV 665 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+KGSRVKEMICPS EVLESSVRHYSI Sbjct: 666 RIVPTFKIYKKGSRVKEMICPSQEVLESSVRHYSI 700 >ref|XP_011082756.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Sesamum indicum] Length = 701 Score = 162 bits (410), Expect = 8e-38 Identities = 77/95 (81%), Positives = 87/95 (91%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAA+SSP ASVVHFK S+++C+QIS FLDTLC RYPS+NFLKVD+EES IA AENV Sbjct: 607 QFRAAVSSPGASVVHFKTGSSIECEQISPFLDTLCTRYPSINFLKVDIEESAAIAHAENV 666 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIYRKG+RVKEMICPSPEVLESSVRHYSI Sbjct: 667 RIVPTFKIYRKGARVKEMICPSPEVLESSVRHYSI 701 >ref|XP_009604807.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Nicotiana tomentosiformis] Length = 701 Score = 162 bits (410), Expect = 8e-38 Identities = 78/95 (82%), Positives = 88/95 (92%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAISS ASVVHFKA+SNLQCKQIS FLDTL ++PS++FLKVDVEESPTIA AEN+ Sbjct: 607 QFRAAISSSGASVVHFKAASNLQCKQISSFLDTLSTKFPSISFLKVDVEESPTIATAENI 666 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+ GSRVKEM+CPSPEVLESSVRHYSI Sbjct: 667 RIVPTFKIYKNGSRVKEMVCPSPEVLESSVRHYSI 701 >ref|XP_009794169.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Nicotiana sylvestris] Length = 703 Score = 162 bits (409), Expect = 1e-37 Identities = 78/95 (82%), Positives = 88/95 (92%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAISS ASVVHFKA+SNLQCKQIS FLDTL ++PS++FLKVDVEESPTIA AEN+ Sbjct: 609 QFRAAISSSGASVVHFKAASNLQCKQISPFLDTLSTKFPSISFLKVDVEESPTIATAENI 668 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+ GSRVKEM+CPSPEVLESSVRHYSI Sbjct: 669 RIVPTFKIYKNGSRVKEMVCPSPEVLESSVRHYSI 703 >gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlisea aurea] Length = 684 Score = 156 bits (394), Expect = 6e-36 Identities = 73/94 (77%), Positives = 85/94 (90%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAA++SP ASVVHF+ S+N +CKQIS FLDTLC +YPSVNFLKVD++E+ IA AENV Sbjct: 591 QFRAAVTSPGASVVHFRTSNNTECKQISAFLDTLCNKYPSVNFLKVDIDEAVAIAEAENV 650 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIYRKG RVKEMICP+PEVLESSVRHYS Sbjct: 651 RIVPTFKIYRKGKRVKEMICPTPEVLESSVRHYS 684 >emb|CDP06000.1| unnamed protein product [Coffea canephora] Length = 692 Score = 154 bits (390), Expect = 2e-35 Identities = 77/95 (81%), Positives = 84/95 (88%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAISSP ASVVHF ASSNLQCKQIS LD LCA+YPS+NFLKVDVE SP IA AE+V Sbjct: 598 QFRAAISSPCASVVHFLASSNLQCKQISPVLDALCAKYPSINFLKVDVEGSPAIANAEHV 657 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+ G RVKEMICPS E+LESSVRHYSI Sbjct: 658 RIVPTFKIYKNGRRVKEMICPSKELLESSVRHYSI 692 >ref|XP_012850688.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Erythranthe guttatus] Length = 696 Score = 152 bits (385), Expect = 6e-35 Identities = 72/95 (75%), Positives = 86/95 (90%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QF++AISS A+VVHF++ SN+QCKQIS FLDTLC RYPS++FLKVD+EESP IA AENV Sbjct: 602 QFKSAISSSGATVVHFESCSNVQCKQISPFLDTLCTRYPSISFLKVDIEESPAIAQAENV 661 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIYRKG RVKE++CPS EVLES+VRHYSI Sbjct: 662 RIVPTFKIYRKGIRVKEIVCPSHEVLESTVRHYSI 696 >gb|EYU26330.1| hypothetical protein MIMGU_mgv1a002333mg [Erythranthe guttata] Length = 687 Score = 152 bits (385), Expect = 6e-35 Identities = 72/95 (75%), Positives = 86/95 (90%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QF++AISS A+VVHF++ SN+QCKQIS FLDTLC RYPS++FLKVD+EESP IA AENV Sbjct: 593 QFKSAISSSGATVVHFESCSNVQCKQISPFLDTLCTRYPSISFLKVDIEESPAIAQAENV 652 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIYRKG RVKE++CPS EVLES+VRHYSI Sbjct: 653 RIVPTFKIYRKGIRVKEIVCPSHEVLESTVRHYSI 687 >ref|XP_010277046.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X1 [Nelumbo nucifera] Length = 716 Score = 152 bits (383), Expect = 1e-34 Identities = 73/95 (76%), Positives = 84/95 (88%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QF+AAISSP SVVHFKA+ N QC+QIS F+DTLC RYPSVNFLKVDVEESP +A AE+V Sbjct: 622 QFKAAISSPGVSVVHFKAALNQQCEQISPFVDTLCLRYPSVNFLKVDVEESPAVAKAESV 681 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+ GSRVKEMICPS +VLE SVRHYS+ Sbjct: 682 RIVPTFKIYKNGSRVKEMICPSHQVLEYSVRHYSL 716 >ref|XP_012078581.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Jatropha curcas] gi|643722792|gb|KDP32526.1| hypothetical protein JCGZ_14729 [Jatropha curcas] Length = 688 Score = 151 bits (382), Expect = 1e-34 Identities = 71/94 (75%), Positives = 83/94 (88%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAIS P SVVHFK+SSNL CKQIS F+DTLC RYPS+NFLKVD+E+ PTIA AENV Sbjct: 594 QFRAAISLPGVSVVHFKSSSNLHCKQISPFVDTLCIRYPSINFLKVDIEDHPTIANAENV 653 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIY+ GSRVKE++CPS ++LE SVRHYS Sbjct: 654 RIVPTFKIYKNGSRVKEIVCPSRDMLEHSVRHYS 687 >gb|KEH38622.1| TPR repeat thioredoxin TTL1-like protein [Medicago truncatula] Length = 696 Score = 151 bits (381), Expect = 2e-34 Identities = 69/95 (72%), Positives = 84/95 (88%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFR+AIS P SVVHF+ +SN QCKQIS FLDTLC RYPS+NFLKVD++E+PT+A AENV Sbjct: 602 QFRSAISLPGVSVVHFEVASNSQCKQISPFLDTLCGRYPSINFLKVDIQENPTVATAENV 661 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +++PTFKIY+ GSRVKE+ICPS ++LE SVRHYSI Sbjct: 662 RVVPTFKIYKNGSRVKEIICPSRDMLEHSVRHYSI 696 >ref|XP_011460778.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Fragaria vesca subsp. vesca] Length = 693 Score = 150 bits (380), Expect = 2e-34 Identities = 71/94 (75%), Positives = 82/94 (87%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAI P SVVHFKA+S+LQCKQIS F+DTLCARYPS+NFLKVD+EE+P +A ENV Sbjct: 599 QFRAAICLPGVSVVHFKAASDLQCKQISPFVDTLCARYPSINFLKVDIEETPAVANIENV 658 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 KI+PTFKIY+ GSRVKEM+CP E+LE SVRHYS Sbjct: 659 KIVPTFKIYKHGSRVKEMVCPCREMLEHSVRHYS 692 >ref|XP_012457385.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X2 [Gossypium raimondii] Length = 688 Score = 150 bits (378), Expect = 4e-34 Identities = 71/94 (75%), Positives = 80/94 (85%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAIS P SVVHFK +SNLQCKQIS F+D LC RYPS+NFLKVD+ ESP IA ENV Sbjct: 594 QFRAAISLPGISVVHFKMASNLQCKQISPFVDALCGRYPSINFLKVDINESPVIANTENV 653 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIY+ GSRVKEM+CPS E+LE SVRHYS Sbjct: 654 RIVPTFKIYKNGSRVKEMVCPSREMLEHSVRHYS 687 >ref|XP_012457374.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X1 [Gossypium raimondii] gi|763745760|gb|KJB13199.1| hypothetical protein B456_002G061800 [Gossypium raimondii] Length = 702 Score = 150 bits (378), Expect = 4e-34 Identities = 71/94 (75%), Positives = 80/94 (85%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAIS P SVVHFK +SNLQCKQIS F+D LC RYPS+NFLKVD+ ESP IA ENV Sbjct: 608 QFRAAISLPGISVVHFKMASNLQCKQISPFVDALCGRYPSINFLKVDINESPVIANTENV 667 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIY+ GSRVKEM+CPS E+LE SVRHYS Sbjct: 668 RIVPTFKIYKNGSRVKEMVCPSREMLEHSVRHYS 701 >ref|XP_010279112.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 716 Score = 149 bits (376), Expect = 7e-34 Identities = 72/95 (75%), Positives = 82/95 (86%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAISSP SVVHFKA SN QC+QIS F DTLC +YPS+NFLKVDV ESP +A AE+V Sbjct: 622 QFRAAISSPGVSVVHFKAPSNQQCEQISPFFDTLCHQYPSMNFLKVDVNESPAVAKAESV 681 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYSI 171 +I+PTFKIY+ GSRVKEMICPS +VLE SVRHYS+ Sbjct: 682 RIVPTFKIYKNGSRVKEMICPSHQVLEYSVRHYSL 716 >ref|XP_004489036.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Cicer arietinum] Length = 691 Score = 148 bits (374), Expect = 1e-33 Identities = 67/94 (71%), Positives = 83/94 (88%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAIS P SVVHF+ +SN QCKQIS F+DTLC+RYPS+NFLKVD++E+PT+ AENV Sbjct: 597 QFRAAISLPGVSVVHFEVASNSQCKQISPFVDTLCSRYPSINFLKVDIQENPTVGTAENV 656 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIY+ GSRVKE++CPS ++LE SVRHYS Sbjct: 657 RIVPTFKIYKNGSRVKEIVCPSRDMLEHSVRHYS 690 >ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] gi|561022663|gb|ESW21393.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] Length = 688 Score = 148 bits (373), Expect = 2e-33 Identities = 68/94 (72%), Positives = 80/94 (85%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAI P SVVHF+ SN QCKQIS F+DTLC RYPS+NFLKVD++ESPT+ AENV Sbjct: 594 QFRAAICLPGVSVVHFEVGSNSQCKQISPFVDTLCGRYPSINFLKVDIQESPTVGTAENV 653 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIY+ GSRVKE++CPS E+LE SVRHYS Sbjct: 654 RIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYS 687 >ref|XP_011016487.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like isoform X2 [Populus euphratica] Length = 681 Score = 147 bits (372), Expect = 2e-33 Identities = 70/94 (74%), Positives = 82/94 (87%) Frame = -3 Query: 455 QFRAAISSPSASVVHFKASSNLQCKQISLFLDTLCARYPSVNFLKVDVEESPTIALAENV 276 QFRAAIS P SVVHFK+SSN+ CKQIS F+DTLC RYPS+NFLKVDVEE P IA AE+V Sbjct: 587 QFRAAISLPGVSVVHFKSSSNVHCKQISPFVDTLCGRYPSINFLKVDVEEHPAIANAEDV 646 Query: 275 KIIPTFKIYRKGSRVKEMICPSPEVLESSVRHYS 174 +I+PTFKIY+ G+RVKEM+CPS +VLE SVR+YS Sbjct: 647 RIVPTFKIYKNGNRVKEMVCPSHDVLEHSVRYYS 680