BLASTX nr result
ID: Forsythia21_contig00018905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018905 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099088.1| PREDICTED: ATP-dependent zinc metalloproteas... 69 1e-09 ref|XP_009620939.1| PREDICTED: mitochondrial inner membrane i-AA... 60 6e-07 ref|XP_009788646.1| PREDICTED: uncharacterized protein LOC104236... 59 1e-06 >ref|XP_011099088.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic [Sesamum indicum] Length = 616 Score = 68.9 bits (167), Expect = 1e-09 Identities = 40/60 (66%), Positives = 41/60 (68%) Frame = +2 Query: 41 MASFPLASTDGFLIAQEKCKLHVGNFKLLGRHGALSCSLPNNCFNSVSKPLLGMNYSCKS 220 MASFPLA DGFLIAQE L VGN KLLG H LS SL NCF+SVS PLL SC S Sbjct: 1 MASFPLAWNDGFLIAQENLNLCVGNSKLLGGHRNLSFSLSQNCFSSVSCPLL---LSCSS 57 >ref|XP_009620939.1| PREDICTED: mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 [Nicotiana tomentosiformis] Length = 668 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +2 Query: 41 MASFPLASTDGFLIAQEKCKLHVGNFKLLGRHGALSCSLPNNCFNSVSKPLLGMNY 208 MASFPL S D L++ +K + H+G F+ L R +CSL N+CF S PLLG+NY Sbjct: 1 MASFPLVSNDCLLVSHKKWQPHIGKFEPLSRFKNQTCSLSNSCFTSSCVPLLGLNY 56 >ref|XP_009788646.1| PREDICTED: uncharacterized protein LOC104236427 [Nicotiana sylvestris] Length = 684 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +2 Query: 41 MASFPLASTDGFLIAQEKCKLHVGNFKLLGRHGALSCSLPNNCFNSVSKPLLGMNY 208 MASFPL S + L++ +K + H+G F+ L R SCSL N+CF S PLLG+NY Sbjct: 1 MASFPLVSNERLLVSHKKWQPHLGKFEPLSRFKNQSCSLSNSCFTSSCVPLLGLNY 56