BLASTX nr result
ID: Forsythia21_contig00018622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018622 (203 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274131.2| PREDICTED: peroxidase 55-like [Vitis vinifer... 70 6e-10 ref|XP_012070272.1| PREDICTED: peroxidase 55 [Jatropha curcas] g... 59 1e-06 >ref|XP_002274131.2| PREDICTED: peroxidase 55-like [Vitis vinifera] gi|731418624|ref|XP_010660749.1| PREDICTED: peroxidase 55-like [Vitis vinifera] Length = 336 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 144 VQSKLREMKTWKGLCLFMLLILVMRGEGQLKENFYSSSCPNVEAIVRQ 1 V ++R+M+ W+ LCL M+L++V +GEGQL ENFYSSSCPNVEAIV+Q Sbjct: 7 VLMEMRKMQAWRRLCLVMVLLMVGQGEGQLAENFYSSSCPNVEAIVKQ 54 >ref|XP_012070272.1| PREDICTED: peroxidase 55 [Jatropha curcas] gi|643740680|gb|KDP46270.1| hypothetical protein JCGZ_10110 [Jatropha curcas] Length = 326 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -3 Query: 120 KTWKGLCLFMLLILVMRGEGQLKENFYSSSCPNVEAIVRQ 1 K W L L +L++++ RGEGQL ENFYSSSCPNVEAIV+Q Sbjct: 5 KDWFMLILIVLMMMIRRGEGQLIENFYSSSCPNVEAIVKQ 44