BLASTX nr result
ID: Forsythia21_contig00018559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018559 (240 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846544.1| PREDICTED: uncharacterized protein LOC105966... 64 5e-08 >ref|XP_012846544.1| PREDICTED: uncharacterized protein LOC105966530 [Erythranthe guttatus] Length = 303 Score = 63.5 bits (153), Expect = 5e-08 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 5/81 (6%) Frame = -3 Query: 229 MQIQTQICTPCCAPVSR-----TAVFSRKPVGIITKKNSNWRVSFLSGDLRRNLWHWRKK 65 MQI QI TPC P R T FSR +G+ TK+ S L D R L HW KK Sbjct: 1 MQILNQIFTPCAFPQIRSSLYQTLAFSRTRLGLSTKRRWIAGGSLLFVDSRNKLCHWGKK 60 Query: 64 SEYAIISAVEEGNFGAHVQRK 2 + A++SAV EGN GA VQ+K Sbjct: 61 EKMAVVSAVGEGNLGAGVQKK 81