BLASTX nr result
ID: Forsythia21_contig00018341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018341 (550 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 79 1e-12 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +3 Query: 141 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLL*AVTRNQLRSIQIGQNLSFF 290 RDVAQLGSAFVLGTKCHGFKSCHPYLLLL AV++N++RSI+I + F+ Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRSIEIARTPYFY 50