BLASTX nr result
ID: Forsythia21_contig00018196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018196 (1474 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858612.1| PREDICTED: uncharacterized protein LOC105977... 80 7e-15 ref|XP_011084779.1| PREDICTED: uncharacterized protein LOC105166... 81 1e-14 ref|XP_011076560.1| PREDICTED: uncharacterized protein LOC105160... 79 3e-14 emb|CDP13869.1| unnamed protein product [Coffea canephora] 79 3e-14 gb|EPS67188.1| hypothetical protein M569_07585 [Genlisea aurea] 79 7e-14 ref|XP_012839970.1| PREDICTED: uncharacterized protein LOC105960... 78 2e-13 ref|XP_009759160.1| PREDICTED: uncharacterized protein LOC104211... 75 3e-13 ref|XP_009607286.1| PREDICTED: uncharacterized protein LOC104101... 75 3e-13 ref|XP_006358167.1| PREDICTED: uncharacterized protein LOC102591... 75 3e-13 ref|XP_006357306.1| PREDICTED: uncharacterized protein LOC102585... 76 4e-13 ref|XP_004240838.1| PREDICTED: uncharacterized protein LOC101246... 76 4e-13 ref|XP_004235209.1| PREDICTED: uncharacterized protein LOC101249... 74 4e-13 ref|XP_009781124.1| PREDICTED: uncharacterized protein LOC104230... 77 6e-13 ref|XP_009363756.1| PREDICTED: uncharacterized protein LOC103953... 72 2e-12 ref|XP_009362743.1| PREDICTED: uncharacterized protein LOC103952... 72 2e-12 ref|XP_008376344.1| PREDICTED: uncharacterized protein LOC103439... 72 2e-12 ref|XP_008375228.1| PREDICTED: uncharacterized protein LOC103438... 72 2e-12 ref|XP_008234147.1| PREDICTED: uncharacterized protein LOC103333... 72 2e-12 ref|XP_008234148.1| PREDICTED: uncharacterized protein LOC103333... 72 2e-12 ref|XP_007217959.1| hypothetical protein PRUPE_ppa005227mg [Prun... 72 2e-12 >ref|XP_012858612.1| PREDICTED: uncharacterized protein LOC105977781 [Erythranthe guttatus] gi|604300300|gb|EYU20143.1| hypothetical protein MIMGU_mgv1a005588mg [Erythranthe guttata] Length = 478 Score = 80.5 bits (197), Expect(2) = 7e-15 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPCSGRRVVAKK RG LDGFVNSVKKLQR+EISSKR Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKKLQRREISSKR 47 Score = 29.3 bits (64), Expect(2) = 7e-15 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >ref|XP_011084779.1| PREDICTED: uncharacterized protein LOC105166952 [Sesamum indicum] gi|747075487|ref|XP_011084780.1| PREDICTED: uncharacterized protein LOC105166952 [Sesamum indicum] gi|747075489|ref|XP_011084781.1| PREDICTED: uncharacterized protein LOC105166952 [Sesamum indicum] Length = 477 Score = 80.9 bits (198), Expect(2) = 1e-14 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPCSGRRVVAKK RG LDGFVNSVKKLQR+EISSKR Sbjct: 1 MEGRRITASPRPCSGRRVVAKKRPRGGLDGFVNSVKKLQRREISSKR 47 Score = 28.1 bits (61), Expect(2) = 1e-14 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSD+QERFRNIRL Sbjct: 53 MSDSQERFRNIRL 65 >ref|XP_011076560.1| PREDICTED: uncharacterized protein LOC105160776 [Sesamum indicum] Length = 477 Score = 78.6 bits (192), Expect(2) = 3e-14 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPC GRRVVAKK RG LDGFVNSVKKLQR+EISSKR Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGLDGFVNSVKKLQRREISSKR 47 Score = 29.3 bits (64), Expect(2) = 3e-14 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >emb|CDP13869.1| unnamed protein product [Coffea canephora] Length = 477 Score = 78.6 bits (192), Expect(2) = 3e-14 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPCSGRRVVAKK RG +DGFVNSVKKLQR+EISS+R Sbjct: 1 MDGRRITASPRPCSGRRVVAKKRPRGGMDGFVNSVKKLQRREISSRR 47 Score = 29.3 bits (64), Expect(2) = 3e-14 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >gb|EPS67188.1| hypothetical protein M569_07585 [Genlisea aurea] Length = 470 Score = 79.0 bits (193), Expect(2) = 7e-14 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPCSGRRV+AKK R DLDGFVNSVKKLQR+EISS+R Sbjct: 1 MEGRRITASPRPCSGRRVLAKKRPRSDLDGFVNSVKKLQRREISSRR 47 Score = 27.3 bits (59), Expect(2) = 7e-14 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNI L Sbjct: 53 MSDAQERFRNIHL 65 >ref|XP_012839970.1| PREDICTED: uncharacterized protein LOC105960361 [Erythranthe guttatus] gi|604330056|gb|EYU35176.1| hypothetical protein MIMGU_mgv1a005610mg [Erythranthe guttata] Length = 477 Score = 77.8 bits (190), Expect(2) = 2e-13 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPC+GRRVVAKK RG +DGFVNSVKKLQR+EIS+KR Sbjct: 1 MDGRRITASPRPCTGRRVVAKKRRRGGIDGFVNSVKKLQRREISTKR 47 Score = 27.3 bits (59), Expect(2) = 2e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 M DAQERFRNIRL Sbjct: 53 MCDAQERFRNIRL 65 >ref|XP_009759160.1| PREDICTED: uncharacterized protein LOC104211756 [Nicotiana sylvestris] Length = 478 Score = 75.1 bits (183), Expect(2) = 3e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRI A PRPC GRRVVAKK RG +DGFVNSVKKLQR+EISSKR Sbjct: 1 MDGRRICASPRPCCGRRVVAKKRPRGGVDGFVNSVKKLQRREISSKR 47 Score = 29.3 bits (64), Expect(2) = 3e-13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >ref|XP_009607286.1| PREDICTED: uncharacterized protein LOC104101522 [Nicotiana tomentosiformis] Length = 478 Score = 75.1 bits (183), Expect(2) = 3e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRI A PRPC GRRVVAKK RG +DGFVNSVKKLQR+EISSKR Sbjct: 1 MDGRRICASPRPCCGRRVVAKKRPRGGVDGFVNSVKKLQRREISSKR 47 Score = 29.3 bits (64), Expect(2) = 3e-13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >ref|XP_006358167.1| PREDICTED: uncharacterized protein LOC102591491 [Solanum tuberosum] Length = 478 Score = 74.7 bits (182), Expect(2) = 3e-13 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRI+A PRPC GRRVVAKK RG +DGFVNSVKKLQR+EI SKR Sbjct: 1 MDGRRISASPRPCCGRRVVAKKRSRGGIDGFVNSVKKLQRREICSKR 47 Score = 29.3 bits (64), Expect(2) = 3e-13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >ref|XP_006357306.1| PREDICTED: uncharacterized protein LOC102585852 isoform X1 [Solanum tuberosum] gi|565381923|ref|XP_006357307.1| PREDICTED: uncharacterized protein LOC102585852 isoform X2 [Solanum tuberosum] Length = 480 Score = 76.3 bits (186), Expect(2) = 4e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPC GRRVVAKK RG +DGFVNSVKKLQR+EI SKR Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKKLQRREIGSKR 47 Score = 27.3 bits (59), Expect(2) = 4e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNI L Sbjct: 53 MSDAQERFRNIHL 65 >ref|XP_004240838.1| PREDICTED: uncharacterized protein LOC101246351 isoform X1 [Solanum lycopersicum] Length = 480 Score = 76.3 bits (186), Expect(2) = 4e-13 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRITA PRPC GRRVVAKK RG +DGFVNSVKKLQR+EI SKR Sbjct: 1 MDGRRITASPRPCCGRRVVAKKRPRGGMDGFVNSVKKLQRREIGSKR 47 Score = 27.3 bits (59), Expect(2) = 4e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNI L Sbjct: 53 MSDAQERFRNIHL 65 >ref|XP_004235209.1| PREDICTED: uncharacterized protein LOC101249157 [Solanum lycopersicum] Length = 478 Score = 74.3 bits (181), Expect(2) = 4e-13 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRI+A PRPC GRRVVAKK RG +DGFVNSVKKLQR+EI SKR Sbjct: 1 MDGRRISASPRPCCGRRVVAKKRSRGGVDGFVNSVKKLQRREICSKR 47 Score = 29.3 bits (64), Expect(2) = 4e-13 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 53 MSDAQERFRNIRL 65 >ref|XP_009781124.1| PREDICTED: uncharacterized protein LOC104230086 [Nicotiana sylvestris] Length = 480 Score = 76.6 bits (187), Expect(2) = 6e-13 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 1332 MVGRRITARPRPCSGRRVVAKKPWRGDLDGFVNSVKKLQRKEISSKR 1192 M GRRI+A PRPCSGRRVVAKK RG +DGFVNSVKKLQR+EI SKR Sbjct: 1 MDGRRISASPRPCSGRRVVAKKRPRGGMDGFVNSVKKLQRREIGSKR 47 Score = 26.6 bits (57), Expect(2) = 6e-13 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 M+DAQERFRNI+L Sbjct: 53 MNDAQERFRNIQL 65 >ref|XP_009363756.1| PREDICTED: uncharacterized protein LOC103953706 [Pyrus x bretschneideri] Length = 478 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRIGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67 >ref|XP_009362743.1| PREDICTED: uncharacterized protein LOC103952788 [Pyrus x bretschneideri] Length = 478 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRIGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67 >ref|XP_008376344.1| PREDICTED: uncharacterized protein LOC103439562 isoform X1 [Malus domestica] Length = 478 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRIGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67 >ref|XP_008375228.1| PREDICTED: uncharacterized protein LOC103438463 [Malus domestica] Length = 478 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRIGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67 >ref|XP_008234147.1| PREDICTED: uncharacterized protein LOC103333130 isoform X1 [Prunus mume] Length = 478 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRVGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67 >ref|XP_008234148.1| PREDICTED: uncharacterized protein LOC103333130 isoform X2 [Prunus mume] Length = 477 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRVGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67 >ref|XP_007217959.1| hypothetical protein PRUPE_ppa005227mg [Prunus persica] gi|462414421|gb|EMJ19158.1| hypothetical protein PRUPE_ppa005227mg [Prunus persica] Length = 471 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 1326 GRRITARPRPCSGRRVVAKK-PWRGDLDGFVNSVKKLQRKEISSKR 1192 GRRI+A PRPC+GRRVVAKK P G +DGFVNSVKKLQR+EISSKR Sbjct: 4 GRRISASPRPCNGRRVVAKKRPRVGGVDGFVNSVKKLQRREISSKR 49 Score = 29.3 bits (64), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 1175 MSDAQERFRNIRL 1137 MSDAQERFRNIRL Sbjct: 55 MSDAQERFRNIRL 67