BLASTX nr result
ID: Forsythia21_contig00018077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00018077 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856380.1| PREDICTED: photosynthetic NDH subunit of sub... 62 1e-07 ref|XP_011072397.1| PREDICTED: uncharacterized protein LOC105157... 62 2e-07 >ref|XP_012856380.1| PREDICTED: photosynthetic NDH subunit of subcomplex B 3, chloroplastic [Erythranthe guttatus] gi|604301896|gb|EYU21482.1| hypothetical protein MIMGU_mgv1a014196mg [Erythranthe guttata] Length = 198 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 364 DSRGLVVIQQLPEWKGHDWVYGKEPPEDETAII 266 DS+GLVVIQQLPEWK H+W YGK+PPEDE I Sbjct: 166 DSKGLVVIQQLPEWKAHEWTYGKDPPEDEITYI 198 >ref|XP_011072397.1| PREDICTED: uncharacterized protein LOC105157664 [Sesamum indicum] Length = 193 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -2 Query: 364 DSRGLVVIQQLPEWKGHDWVYGKEPPEDE 278 DSRG+VVIQQLPEWK H W YGKEPPEDE Sbjct: 159 DSRGVVVIQQLPEWKAHQWTYGKEPPEDE 187