BLASTX nr result
ID: Forsythia21_contig00017101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00017101 (373 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011650747.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 175 9e-42 gb|KHN46724.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja] 175 1e-41 gb|KHN29339.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja] 175 1e-41 ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 175 1e-41 ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 175 1e-41 ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805... 175 1e-41 ref|XP_007135093.1| hypothetical protein PHAVU_010G100200g [Phas... 175 1e-41 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 175 1e-41 ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 175 1e-41 ref|XP_012471798.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 174 2e-41 gb|KJB39653.1| hypothetical protein B456_007G023700 [Gossypium r... 174 2e-41 ref|XP_012488727.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 174 2e-41 gb|KJB20631.1| hypothetical protein B456_003G157300 [Gossypium r... 174 2e-41 gb|KHF98807.1| Ubiquitin-conjugating enzyme E2 5 -like protein [... 174 2e-41 ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 174 2e-41 ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 174 2e-41 ref|XP_008438030.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 174 2e-41 gb|KEH18845.1| ubiquitin-conjugating enzyme [Medicago truncatula] 174 2e-41 ref|XP_007040285.1| Ubiquitin-conjugating enzyme 5 [Theobroma ca... 174 2e-41 ref|XP_011092673.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 174 3e-41 >ref|XP_011650747.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X3 [Cucumis sativus] Length = 162 Score = 175 bits (444), Expect = 9e-42 Identities = 78/86 (90%), Positives = 85/86 (98%) Frame = -3 Query: 260 GPYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVN 81 GPYHGG+W++RV+LPDAYPYK+PSIGFLNKIYHPNVDE+SGS+CLDVINQTWSPMFDLVN Sbjct: 21 GPYHGGLWRIRVELPDAYPYKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN 80 Query: 80 VFEVFLPQLLLYPNPSDPLNREAAAL 3 VFEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 81 VFEVFLPQLLLYPNPSDPLNGEAAAL 106 >gb|KHN46724.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja] Length = 205 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >gb|KHN29339.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja] Length = 185 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 45 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 104 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 105 FEVFLPQLLLYPNPSDPLNGEAAAL 129 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] gi|734390800|gb|KHN26954.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja] Length = 183 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 [Glycine max] Length = 155 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805356 isoform X1 [Glycine max] Length = 166 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_007135093.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris] gi|561008138|gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris] Length = 183 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 [Glycine max] Length = 183 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Glycine max] gi|734309215|gb|KHM99359.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja] Length = 183 Score = 175 bits (443), Expect = 1e-41 Identities = 79/85 (92%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_012471798.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Gossypium raimondii] Length = 216 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 75 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 134 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 135 FEVFLPQLLLYPNPSDPLNGEAAAL 159 >gb|KJB39653.1| hypothetical protein B456_007G023700 [Gossypium raimondii] Length = 169 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 28 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 87 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 88 FEVFLPQLLLYPNPSDPLNGEAAAL 112 >ref|XP_012488727.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Gossypium raimondii] gi|763772529|gb|KJB39652.1| hypothetical protein B456_007G023700 [Gossypium raimondii] Length = 184 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >gb|KJB20631.1| hypothetical protein B456_003G157300 [Gossypium raimondii] Length = 224 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 83 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 142 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 143 FEVFLPQLLLYPNPSDPLNGEAAAL 167 >gb|KHF98807.1| Ubiquitin-conjugating enzyme E2 5 -like protein [Gossypium arboreum] Length = 184 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum tuberosum] Length = 184 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Solanum lycopersicum] Length = 184 Score = 174 bits (442), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_008438030.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X3 [Cucumis melo] Length = 162 Score = 174 bits (441), Expect = 2e-41 Identities = 77/86 (89%), Positives = 85/86 (98%) Frame = -3 Query: 260 GPYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVN 81 GPYHGG+W++RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVN Sbjct: 21 GPYHGGLWRIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN 80 Query: 80 VFEVFLPQLLLYPNPSDPLNREAAAL 3 VFEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 81 VFEVFLPQLLLYPNPSDPLNGEAAAL 106 >gb|KEH18845.1| ubiquitin-conjugating enzyme [Medicago truncatula] Length = 146 Score = 174 bits (441), Expect = 2e-41 Identities = 79/86 (91%), Positives = 84/86 (97%) Frame = -3 Query: 260 GPYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVN 81 GPY GGVWKVRV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVN Sbjct: 3 GPYQGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN 62 Query: 80 VFEVFLPQLLLYPNPSDPLNREAAAL 3 VFEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 63 VFEVFLPQLLLYPNPSDPLNGEAAAL 88 >ref|XP_007040285.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao] gi|508777530|gb|EOY24786.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao] Length = 184 Score = 174 bits (441), Expect = 2e-41 Identities = 78/85 (91%), Positives = 84/85 (98%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWK+RV+LPDAYPYK+PSIGF+NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127 >ref|XP_011092673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Sesamum indicum] Length = 183 Score = 174 bits (440), Expect = 3e-41 Identities = 79/85 (92%), Positives = 83/85 (97%) Frame = -3 Query: 257 PYHGGVWKVRVKLPDAYPYKAPSIGFLNKIYHPNVDEVSGSICLDVINQTWSPMFDLVNV 78 PYHGGVWKVRV+LPDAYPYK+PSIGF NKIYHPNVDE+SGS+CLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 77 FEVFLPQLLLYPNPSDPLNREAAAL 3 FEVFLPQLLLYPNPSDPLN EAAAL Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAAL 127