BLASTX nr result
ID: Forsythia21_contig00016985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00016985 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CRY49358.1| transcription factor tipo AP2/ERF [Coffea caneph... 60 7e-07 emb|CDP04166.1| unnamed protein product [Coffea canephora] 60 7e-07 ref|XP_011077145.1| PREDICTED: AP2-like ethylene-responsive tran... 58 3e-06 >emb|CRY49358.1| transcription factor tipo AP2/ERF [Coffea canephora] Length = 611 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 202 SSTLPIGGAVKRLKDAENAEMALDIQRKANNGNHNSHLTNGL 77 SSTLPIGGA KRLKDAE AEMALD R NN N +SHLT+G+ Sbjct: 431 SSTLPIGGAAKRLKDAEQAEMALDAHR-TNNDNLSSHLTDGM 471 >emb|CDP04166.1| unnamed protein product [Coffea canephora] Length = 724 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 202 SSTLPIGGAVKRLKDAENAEMALDIQRKANNGNHNSHLTNGL 77 SSTLPIGGA KRLKDAE AEMALD R NN N +SHLT+G+ Sbjct: 494 SSTLPIGGAAKRLKDAEQAEMALDAHR-TNNDNLSSHLTDGM 534 >ref|XP_011077145.1| PREDICTED: AP2-like ethylene-responsive transcription factor BBM2 [Sesamum indicum] Length = 697 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 202 SSTLPIGGAVKRLKDAENAEMALDIQRKANNGNHNSHLTNG 80 SSTLPIGGA KRLKDAENAE AL++ R AN GN + HLT+G Sbjct: 446 SSTLPIGGAAKRLKDAENAETALEMHR-ANEGNLSLHLTDG 485