BLASTX nr result
ID: Forsythia21_contig00016414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00016414 (469 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KER00687.1| hypothetical protein AUEXF2481DRAFT_596 [Aureobas... 68 2e-09 ref|XP_007288375.1| plasma membrane proteolipid 3 [Marssonina br... 68 2e-09 ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melam... 68 2e-09 ref|XP_001547873.1| conserved hypothetical protein [Botrytis cin... 68 2e-09 dbj|GAO19464.1| hypothetical protein UVI_070640 [Ustilaginoidea ... 68 3e-09 gb|KIJ34665.1| hypothetical protein M422DRAFT_181886 [Sphaerobol... 68 3e-09 gb|KEQ87443.1| UPF0057-domain-containing protein [Aureobasidium ... 68 3e-09 gb|KEQ69022.1| UPF0057-domain-containing protein [Aureobasidium ... 68 3e-09 gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium ... 68 3e-09 ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia... 68 3e-09 ref|XP_001539523.1| conserved hypothetical protein [Histoplasma ... 68 3e-09 ref|XP_001239989.1| plasma membrane proteolipid 3 [Coccidioides ... 68 3e-09 ref|XP_569421.1| cation transport-related protein [Cryptococcus ... 68 3e-09 gb|KLU83823.1| plasma membrane proteolipid 3 [Magnaporthiopsis p... 67 4e-09 gb|EPY54281.1| plasma membrane proteolipid Pmp3 [Schizosaccharom... 67 4e-09 gb|EPX74356.1| plasma membrane proteolipid Pmp3 [Schizosaccharom... 67 4e-09 ref|XP_009226059.1| plasma membrane proteolipid 3 [Gaeumannomyce... 67 4e-09 ref|NP_595350.2| plasma membrane proteolipid Pmp3 [Schizosacchar... 67 4e-09 ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe o... 67 4e-09 gb|KIO19944.1| hypothetical protein M407DRAFT_245993 [Tulasnella... 67 5e-09 >gb|KER00687.1| hypothetical protein AUEXF2481DRAFT_596 [Aureobasidium subglaciale EXF-2481] Length = 57 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 +VLPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IVLPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_007288375.1| plasma membrane proteolipid 3 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868336|gb|EKD21373.1| plasma membrane proteolipid 3 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 57 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 V+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 VILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] gi|328859168|gb|EGG08278.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] Length = 57 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 +VLPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IVLPPLGVFLERGCGADFWINILLTILGYIPGIIHALYIILKY 57 >ref|XP_001547873.1| conserved hypothetical protein [Botrytis cinerea B05.10] gi|347835463|emb|CCD50035.1| similar to stress response RCI peptide [Botrytis cinerea T4] Length = 57 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 V+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 VILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >dbj|GAO19464.1| hypothetical protein UVI_070640 [Ustilaginoidea virens] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD GYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINIVLTIFGYIPGIIHALYIILKY 57 >gb|KIJ34665.1| hypothetical protein M422DRAFT_181886 [Sphaerobolus stellatus SS14] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >gb|KEQ87443.1| UPF0057-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINLLLTILGYIPGIIHALYIILKY 57 >gb|KEQ69022.1| UPF0057-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980] gi|154694724|gb|EDN94462.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980 UF-70] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_001539523.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|150413108|gb|EDN08491.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|225561169|gb|EEH09450.1| plasma membrane proteolipid 3 [Histoplasma capsulatum G186AR] gi|240280247|gb|EER43751.1| plasma membrane proteolipid 3 [Histoplasma capsulatum H143] gi|325096659|gb|EGC49969.1| plasma membrane proteolipid 3 [Histoplasma capsulatum H88] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINICLTILGYIPGIIHALYIILKY 57 >ref|XP_001239989.1| plasma membrane proteolipid 3 [Coccidioides immitis RS] gi|303318427|ref|XP_003069213.1| hypothetical protein CPC735_024040 [Coccidioides posadasii C735 delta SOWgp] gi|240108899|gb|EER27068.1| hypothetical protein CPC735_024040 [Coccidioides posadasii C735 delta SOWgp] gi|320039099|gb|EFW21034.1| hypothetical protein CPSG_02877 [Coccidioides posadasii str. Silveira] gi|767016679|gb|EAS28406.3| plasma membrane proteolipid 3 [Coccidioides immitis RS] gi|855531605|gb|KMM66752.1| plasma membrane proteolipid 3 [Coccidioides posadasii RMSCC 3488] gi|859408245|gb|KMP02794.1| plasma membrane proteolipid 3 [Coccidioides immitis RMSCC 2394] gi|875652855|gb|KMU92111.1| hypothetical protein CIHG_09865 [Coccidioides immitis H538.4] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINICLTILGYIPGIIHALYIILKY 57 >ref|XP_569421.1| cation transport-related protein [Cryptococcus neoformans var. neoformans JEC21] gi|338819203|sp|P0CS19.1|PMP3_CRYNB RecName: Full=Plasma membrane proteolipid 3 [Cryptococcus neoformans var. neoformans B-3501A] gi|338819204|sp|P0CS18.1|PMP3_CRYNJ RecName: Full=Plasma membrane proteolipid 3 gi|57225653|gb|AAW42114.1| cation transport-related protein, putative [Cryptococcus neoformans var. neoformans JEC21] Length = 57 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >gb|KLU83823.1| plasma membrane proteolipid 3 [Magnaporthiopsis poae ATCC 64411] Length = 59 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 V+LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 17 VILPPLGVFLERGCGADLLINILLTILGYLPGIIHALYIILKY 59 >gb|EPY54281.1| plasma membrane proteolipid Pmp3 [Schizosaccharomyces cryophilus OY26] Length = 57 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADILINILLCCLGYVPGIIHALYIILKY 57 >gb|EPX74356.1| plasma membrane proteolipid Pmp3 [Schizosaccharomyces octosporus yFS286] Length = 57 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADIIINILLCCLGYVPGIIHALYIILKY 57 >ref|XP_009226059.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402077736|gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 83 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 V+LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 41 VILPPLGVFLERGCGADLLINILLTLLGYLPGIIHALYIILKY 83 >ref|NP_595350.2| plasma membrane proteolipid Pmp3 [Schizosaccharomyces pombe 972h-] gi|395398457|sp|Q9C1W4.2|PMP3_SCHPO RecName: Full=Plasma membrane proteolipid 3 gi|347834269|emb|CAC22612.2| plasma membrane proteolipid Pmp3 [Schizosaccharomyces pombe] Length = 57 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 ++LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 15 IILPPLGVFLERGCGADVIINILLCCLGYVPGIIHALYIILKY 57 >ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|351639495|gb|EHA47359.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|440472934|gb|ELQ41764.1| hypothetical protein OOU_Y34scaffold00255g62 [Magnaporthe oryzae Y34] gi|440478702|gb|ELQ59512.1| hypothetical protein OOW_P131scaffold01349g18 [Magnaporthe oryzae P131] Length = 57 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 V+LPPLGVF+ERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 VILPPLGVFMERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >gb|KIO19944.1| hypothetical protein M407DRAFT_245993 [Tulasnella calospora MUT 4182] Length = 57 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/43 (76%), Positives = 33/43 (76%) Frame = -3 Query: 467 VVLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 339 VVLPPLGVF ERGCGAD LGYIPGIIHALYIILKY Sbjct: 15 VVLPPLGVFFERGCGADLLINILLTVLGYIPGIIHALYIILKY 57