BLASTX nr result
ID: Forsythia21_contig00014986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014986 (401 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100931.1| PREDICTED: RNA-binding protein 39 [Sesamum i... 72 1e-10 ref|XP_012853425.1| PREDICTED: RNA-binding protein 39-like [Eryt... 61 3e-07 ref|XP_010312457.1| PREDICTED: RNA-binding protein 39 [Solanum l... 57 4e-06 ref|XP_006351113.1| PREDICTED: RNA-binding protein 39-like isofo... 57 4e-06 emb|CDP12846.1| unnamed protein product [Coffea canephora] 57 6e-06 ref|XP_009774937.1| PREDICTED: RNA-binding protein 39 [Nicotiana... 56 8e-06 ref|XP_009608714.1| PREDICTED: RNA-binding protein 39 [Nicotiana... 56 8e-06 >ref|XP_011100931.1| PREDICTED: RNA-binding protein 39 [Sesamum indicum] Length = 587 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNGPSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEK VEETNGPSK KET DKEKDRE+SEKGY Sbjct: 1 MDFDEYDYLEKAVEETNGPSK---KETPDKEKDREKSEKGY 38 >ref|XP_012853425.1| PREDICTED: RNA-binding protein 39-like [Erythranthe guttatus] gi|604304814|gb|EYU24065.1| hypothetical protein MIMGU_mgv1a002916mg [Erythranthe guttata] Length = 626 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNGPSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEK VEETNGP+K ET DK DRE+S+KG+ Sbjct: 1 MDFDEYDYLEKAVEETNGPAK---NETPDKGNDREKSDKGH 38 >ref|XP_010312457.1| PREDICTED: RNA-binding protein 39 [Solanum lycopersicum] Length = 576 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNGPSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEKTVEETNG S + + ++ ++E+SEKGY Sbjct: 1 MDFDEYDYLEKTVEETNGTSTKSKDKDNNSSAEKEKSEKGY 41 >ref|XP_006351113.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Solanum tuberosum] Length = 578 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNGPSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEKTVEETNG S + + ++ ++E+SEKGY Sbjct: 1 MDFDEYDYLEKTVEETNGTSTKSKDKDNNSSAEKEKSEKGY 41 >emb|CDP12846.1| unnamed protein product [Coffea canephora] Length = 220 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNG-PSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEKTVEETNG PSKT KET D + EKGY Sbjct: 1 MDFDEYDYLEKTVEETNGPPSKT--KETKDSAEKERDKEKGY 40 >ref|XP_009774937.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris] gi|698571660|ref|XP_009774938.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris] gi|698571663|ref|XP_009774939.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris] Length = 582 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNGPSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEKTVEE NG T +K+ ++ ++E+SEK Y Sbjct: 1 MDFDEYDYLEKTVEEPNGGPSTKSKDNNNSSAEKEKSEKAY 41 >ref|XP_009608714.1| PREDICTED: RNA-binding protein 39 [Nicotiana tomentosiformis] Length = 587 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -1 Query: 290 MDFDEYDYLEKTVEETNGPSKTAAKETSDKEKDRERSEKGY 168 MDFDEYDYLEKTVEE NG T +K+ ++ ++E+SEK Y Sbjct: 1 MDFDEYDYLEKTVEEPNGGPSTKSKDNNNSSAEKEKSEKAY 41