BLASTX nr result
ID: Forsythia21_contig00014922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014922 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074728.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 82 1e-13 ref|XP_010935220.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 80 7e-13 ref|XP_010935219.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 80 7e-13 ref|XP_008781246.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 79 1e-12 ref|XP_009408196.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 77 6e-12 gb|KFK34459.1| hypothetical protein AALP_AA5G148100 [Arabis alpina] 75 1e-11 ref|XP_012839213.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 75 2e-11 gb|KDO85020.1| hypothetical protein CISIN_1g041164mg [Citrus sin... 75 2e-11 gb|EYU36819.1| hypothetical protein MIMGU_mgv1a009088mg [Erythra... 75 2e-11 ref|XP_006435296.1| hypothetical protein CICLE_v10001644mg [Citr... 75 2e-11 ref|XP_009793260.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 75 2e-11 ref|XP_009592937.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 75 2e-11 ref|XP_006355236.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 74 3e-11 ref|XP_004246060.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 74 3e-11 ref|XP_006301165.1| hypothetical protein CARUB_v10021562mg, part... 74 4e-11 ref|XP_006390227.1| hypothetical protein EUTSA_v10018770mg [Eutr... 74 5e-11 ref|XP_006390226.1| hypothetical protein EUTSA_v10018770mg [Eutr... 74 5e-11 dbj|BAJ33655.1| unnamed protein product [Thellungiella halophila] 74 5e-11 ref|XP_010471767.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 73 7e-11 ref|XP_010428668.1| PREDICTED: cytoplasmic tRNA 2-thiolation pro... 73 7e-11 >ref|XP_011074728.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Sesamum indicum] Length = 359 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K +GGR C++CNDRRPALKRPKTLEQIC+ECFY VFEDEIH Sbjct: 12 KPRGGRFCTVCNDRRPALKRPKTLEQICKECFYAVFEDEIH 52 >ref|XP_010935220.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like isoform X2 [Elaeis guineensis] Length = 322 Score = 79.7 bits (195), Expect = 7e-13 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 K GRLCSICN ++PALKRPKTLEQICRECFY+VFE+EIHN Sbjct: 11 KRAAGRLCSICNQKKPALKRPKTLEQICRECFYSVFEEEIHN 52 >ref|XP_010935219.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like isoform X1 [Elaeis guineensis] Length = 362 Score = 79.7 bits (195), Expect = 7e-13 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 K GRLCSICN ++PALKRPKTLEQICRECFY+VFE+EIHN Sbjct: 11 KRAAGRLCSICNQKKPALKRPKTLEQICRECFYSVFEEEIHN 52 >ref|XP_008781246.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Phoenix dactylifera] Length = 362 Score = 79.0 bits (193), Expect = 1e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 115 GRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 GRLCSICN ++PALKRPKTLEQICRECFY+VFE+EIHN Sbjct: 15 GRLCSICNQKKPALKRPKTLEQICRECFYSVFEEEIHN 52 >ref|XP_009408196.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 362 Score = 76.6 bits (187), Expect = 6e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 115 GRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIHN 2 GRLCS CN R+ ALKRPKTLEQICRECFY+VFEDEIHN Sbjct: 15 GRLCSTCNQRKAALKRPKTLEQICRECFYSVFEDEIHN 52 >gb|KFK34459.1| hypothetical protein AALP_AA5G148100 [Arabis alpina] Length = 360 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K G RLC ICN RRP LKRPKTLEQICRECFY VFE+EIH Sbjct: 10 KAGGARLCCICNQRRPVLKRPKTLEQICRECFYEVFEEEIH 50 >ref|XP_012839213.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Erythranthe guttatus] Length = 358 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K +GGR C++CN RR ALKRPKTLEQIC+ECFY VFEDEIH Sbjct: 11 KPRGGRFCTLCNARRAALKRPKTLEQICKECFYEVFEDEIH 51 >gb|KDO85020.1| hypothetical protein CISIN_1g041164mg [Citrus sinensis] Length = 357 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K GGRLCS CN R+ ALKRPKTLEQICRECFY VFE+EIH Sbjct: 9 KKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIH 49 >gb|EYU36819.1| hypothetical protein MIMGU_mgv1a009088mg [Erythranthe guttata] Length = 353 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K +GGR C++CN RR ALKRPKTLEQIC+ECFY VFEDEIH Sbjct: 11 KPRGGRFCTLCNARRAALKRPKTLEQICKECFYEVFEDEIH 51 >ref|XP_006435296.1| hypothetical protein CICLE_v10001644mg [Citrus clementina] gi|568839558|ref|XP_006473748.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Citrus sinensis] gi|557537418|gb|ESR48536.1| hypothetical protein CICLE_v10001644mg [Citrus clementina] Length = 356 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K GGRLCS CN R+ ALKRPKTLEQICRECFY VFE+EIH Sbjct: 9 KKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIH 49 >ref|XP_009793260.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Nicotiana sylvestris] Length = 352 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 115 GRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 GRLC++CN++R ALKRPKTLEQICRECFY VFEDEIH Sbjct: 9 GRLCTLCNEKRAALKRPKTLEQICRECFYAVFEDEIH 45 >ref|XP_009592937.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 {ECO:0000255|HAMAP-Rule:MF_03053}-like [Nicotiana tomentosiformis] Length = 352 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 115 GRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 GRLC++CN++R ALKRPKTLEQICRECFY VFEDEIH Sbjct: 9 GRLCTLCNEKRAALKRPKTLEQICRECFYAVFEDEIH 45 >ref|XP_006355236.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Solanum tuberosum] Length = 352 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 112 RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 RLC++CN++R ALKRPKTLEQICRECFYTVFEDEIH Sbjct: 10 RLCTLCNEKRAALKRPKTLEQICRECFYTVFEDEIH 45 >ref|XP_004246060.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Solanum lycopersicum] Length = 352 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 112 RLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 RLC++CN++R ALKRPKTLEQICRECFYTVFEDEIH Sbjct: 10 RLCTLCNEKRAALKRPKTLEQICRECFYTVFEDEIH 45 >ref|XP_006301165.1| hypothetical protein CARUB_v10021562mg, partial [Capsella rubella] gi|482569875|gb|EOA34063.1| hypothetical protein CARUB_v10021562mg, partial [Capsella rubella] Length = 392 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K G RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 52 KAGGSRLCCICNKRRPVLKRPKTLQQICRECFYEVFEEEIH 92 >ref|XP_006390227.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] gi|557086661|gb|ESQ27513.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] Length = 356 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K G RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 10 KAGGPRLCCICNQRRPVLKRPKTLQQICRECFYEVFEEEIH 50 >ref|XP_006390226.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] gi|557086660|gb|ESQ27512.1| hypothetical protein EUTSA_v10018770mg [Eutrema salsugineum] Length = 304 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K G RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 10 KAGGPRLCCICNQRRPVLKRPKTLQQICRECFYEVFEEEIH 50 >dbj|BAJ33655.1| unnamed protein product [Thellungiella halophila] Length = 253 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 127 KLKGGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 K G RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 10 KAGGPRLCCICNQRRPVLKRPKTLQQICRECFYEVFEEEIH 50 >ref|XP_010471767.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Camelina sativa] Length = 357 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -2 Query: 118 GGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 G RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 13 GSRLCCICNKRRPVLKRPKTLQQICRECFYEVFEEEIH 50 >ref|XP_010428668.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Camelina sativa] Length = 357 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -2 Query: 118 GGRLCSICNDRRPALKRPKTLEQICRECFYTVFEDEIH 5 G RLC ICN RRP LKRPKTL+QICRECFY VFE+EIH Sbjct: 13 GSRLCCICNKRRPVLKRPKTLQQICRECFYEVFEEEIH 50