BLASTX nr result
ID: Forsythia21_contig00014539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014539 (486 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006592406.1| PREDICTED: uncharacterized protein LOC102669... 71 2e-10 gb|KGN43564.1| hypothetical protein Csa_7G045530 [Cucumis sativus] 60 6e-07 >ref|XP_006592406.1| PREDICTED: uncharacterized protein LOC102669050 [Glycine max] Length = 112 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 126 TSKQVWGDNWGVILLCVLRRSRSSHIWRLCRVSEGLSLDYG 248 TS++VWGD GVI LCVLRRS+SS IWRLCRVS GLSLDYG Sbjct: 72 TSRRVWGDEEGVIWLCVLRRSKSSDIWRLCRVSVGLSLDYG 112 >gb|KGN43564.1| hypothetical protein Csa_7G045530 [Cucumis sativus] Length = 80 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = +3 Query: 126 TSKQVWGDNWGVILLCVLRRSRSSHIWRLCRVSEGLSLDYG 248 T K VW DN GVI L VLR+SRSSHIWRLCRV EGLSLDYG Sbjct: 42 TFKWVW-DN-GVISLGVLRKSRSSHIWRLCRVLEGLSLDYG 80