BLASTX nr result
ID: Forsythia21_contig00014491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014491 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099292.1| PREDICTED: isoprenylcysteine alpha-carbonyl ... 61 3e-07 >ref|XP_011099292.1| PREDICTED: isoprenylcysteine alpha-carbonyl methylesterase ICME [Sesamum indicum] Length = 426 Score = 60.8 bits (146), Expect = 3e-07 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 9/66 (13%) Frame = +3 Query: 96 METSTSSPATLDSSDSFENMKQQAETDGLIRASSFP---------RRRAVNKTPSLKARP 248 METS+S PA L S DS + ++ ETD L+R SSFP RRR NK+PSL RP Sbjct: 1 METSSSLPANLLSRDSINEIMEEMETDVLVRVSSFPTAPALNQQRRRRVGNKSPSLAKRP 60 Query: 249 RRQQSF 266 RQQSF Sbjct: 61 CRQQSF 66