BLASTX nr result
ID: Forsythia21_contig00014488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014488 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing fac... 71 3e-10 ref|XP_009598444.1| PREDICTED: serine/arginine-rich splicing fac... 63 7e-08 emb|CDP08889.1| unnamed protein product [Coffea canephora] 62 1e-07 >ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing factor RS40-like isoform X1 [Erythranthe guttatus] Length = 259 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/48 (75%), Positives = 36/48 (75%) Frame = -2 Query: 144 MVLQSYTSLGP*PFAFFMILLSPQFPTCFNIDFMFISDPVAGFAFVYM 1 MV SYT L PFAF M L S QFPTCFNID MFI DPVAGFAFVYM Sbjct: 1 MVPPSYTFLRSLPFAFLMTLHSLQFPTCFNIDIMFIPDPVAGFAFVYM 48 >ref|XP_009598444.1| PREDICTED: serine/arginine-rich splicing factor RS41-like isoform X1 [Nicotiana tomentosiformis] Length = 283 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -2 Query: 144 MVLQSYTSLGP*PFAFFMILLSPQFPTCFNIDFMFISDPVAGFAFV 7 MVLQSY+ L P PFAF M LLSP + TCFNID M ISDPVA F+ Sbjct: 1 MVLQSYSLLRPLPFAFLMTLLSPHYLTCFNIDSMIISDPVAAVEFL 46 >emb|CDP08889.1| unnamed protein product [Coffea canephora] Length = 70 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 278 RVDVKSGLLGNSMIFLDGWFSAFIFCLVPKIHVLVF 171 RVD+KSGLLG SMIFLDGWFSA +F LVPKIHV VF Sbjct: 30 RVDMKSGLLGLSMIFLDGWFSASLFWLVPKIHVNVF 65