BLASTX nr result
ID: Forsythia21_contig00014359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014359 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076022.1| PREDICTED: ATP-dependent zinc metalloproteas... 60 4e-07 >ref|XP_011076022.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial isoform X1 [Sesamum indicum] Length = 791 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 44 MSATLQASLVLKPSFLHFNNLAFCLKPRVSSFASPLILCRSINHKF-NLLPPKSRFLRHR 220 M+ TLQA+L +PS N+L+ LKPR+ +F S + R +N +F + + KSRFL H Sbjct: 1 MTMTLQAALARRPSLPPLNSLSLALKPRIPNFPSQIAFPRGVNDRFSDSVSLKSRFLWHS 60 Query: 221 LVVSCTLN 244 LVVSC+LN Sbjct: 61 LVVSCSLN 68