BLASTX nr result
ID: Forsythia21_contig00014300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014300 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841533.1| PREDICTED: zinc finger protein VAR3, chlorop... 57 5e-06 >ref|XP_012841533.1| PREDICTED: zinc finger protein VAR3, chloroplastic [Erythranthe guttatus] Length = 428 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/53 (56%), Positives = 42/53 (79%) Frame = -2 Query: 159 ATSKLYTLLGTSILRSSLSFSQVPPFRFCKLLPSPSVSLRFHRYSSYAVTLDS 1 ATS+L++LLG S+LRSS +FSQ+ P +F K+ P +LRF+RY+S A+TLDS Sbjct: 2 ATSRLFSLLGPSMLRSSGNFSQIAPLKFNKICLPP--TLRFNRYTSAALTLDS 52