BLASTX nr result
ID: Forsythia21_contig00014248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00014248 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289689.2| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 63 9e-08 ref|XP_010999393.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 63 9e-08 ref|XP_012480106.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 62 1e-07 ref|XP_010028563.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 62 1e-07 ref|XP_002519102.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 62 1e-07 ref|XP_007042718.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 62 1e-07 ref|XP_007042717.1| 4-hydroxy-3-methylbut-2-enyl diphosphate red... 62 1e-07 ref|XP_008454877.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 62 1e-07 gb|KEH30396.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 62 1e-07 ref|XP_004137008.2| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 62 1e-07 gb|AID55341.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductas... 61 3e-07 gb|AGZ84565.1| glucosyltransferase KGT15, partial [Pueraria mont... 61 3e-07 gb|ABI64152.1| hydroxymethylbutenyl diphosphate reductase [Campt... 61 3e-07 emb|CBI32545.3| unnamed protein product [Vitis vinifera] 61 3e-07 ref|NP_001234728.1| ISPH protein [Solanum lycopersicum] gi|26217... 61 3e-07 ref|XP_002313816.1| chloroplast biogenesis family protein [Popul... 61 3e-07 gb|ACD70402.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1... 61 3e-07 ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 61 3e-07 ref|XP_010254975.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 61 3e-07 gb|ABI30631.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductas... 61 3e-07 >ref|XP_004289689.2| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Fragaria vesca subsp. vesca] Length = 495 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ+A Sbjct: 464 GVTSGASTPDKVVEDALIKVFDIKREEALQLA 495 >ref|XP_010999393.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Populus euphratica] Length = 460 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ+A Sbjct: 429 GVTSGASTPDKVVEDALIKVFDIKREEALQLA 460 >ref|XP_012480106.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Gossypium raimondii] gi|763764947|gb|KJB32201.1| hypothetical protein B456_005G229100 [Gossypium raimondii] Length = 463 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ+A Sbjct: 432 GVTSGASTPDKVVEDALIKVFDIKREEALQVA 463 >ref|XP_010028563.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Eucalyptus grandis] gi|629089064|gb|KCW55317.1| hypothetical protein EUGRSUZ_I01241 [Eucalyptus grandis] Length = 467 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDAL+KVFDIKREEALQ+A Sbjct: 436 GVTSGASTPDKVVEDALVKVFDIKREEALQLA 467 >ref|XP_002519102.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, putative [Ricinus communis] gi|223541765|gb|EEF43313.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, putative [Ricinus communis] Length = 466 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDAL+KVFDIKREEALQ+A Sbjct: 435 GVTSGASTPDKVVEDALVKVFDIKREEALQLA 466 >ref|XP_007042718.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase isoform 2 [Theobroma cacao] gi|508706653|gb|EOX98549.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase isoform 2 [Theobroma cacao] Length = 459 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ+A Sbjct: 428 GVTSGASTPDKVVEDALIKVFDIKREEALQVA 459 >ref|XP_007042717.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase isoform 1 [Theobroma cacao] gi|508706652|gb|EOX98548.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase isoform 1 [Theobroma cacao] Length = 462 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ+A Sbjct: 431 GVTSGASTPDKVVEDALIKVFDIKREEALQVA 462 >ref|XP_008454877.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Cucumis melo] Length = 463 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ A Sbjct: 432 GVTSGASTPDKVVEDALIKVFDIKREEALQFA 463 >gb|KEH30396.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Medicago truncatula] Length = 449 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFD+KREEALQ+A Sbjct: 418 GVTSGASTPDKVVEDALIKVFDLKREEALQLA 449 >ref|XP_004137008.2| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Cucumis sativus] gi|700188755|gb|KGN43988.1| hypothetical protein Csa_7G075680 [Cucumis sativus] Length = 468 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKREEALQ A Sbjct: 437 GVTSGASTPDKVVEDALIKVFDIKREEALQFA 468 >gb|AID55341.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductase [Actinidia deliciosa] Length = 465 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED LIKVFDIKREEALQ+A Sbjct: 434 GVTSGASTPDKVVEDVLIKVFDIKREEALQLA 465 >gb|AGZ84565.1| glucosyltransferase KGT15, partial [Pueraria montana var. lobata] Length = 94 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFD+KREEA+Q+A Sbjct: 63 GVTSGASTPDKVVEDALIKVFDLKREEAMQLA 94 >gb|ABI64152.1| hydroxymethylbutenyl diphosphate reductase [Camptotheca acuminata] Length = 459 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED LIKVFDIKREEALQ+A Sbjct: 428 GVTSGASTPDKVVEDVLIKVFDIKREEALQLA 459 >emb|CBI32545.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED LIKVFDIKREEALQ+A Sbjct: 349 GVTSGASTPDKVVEDVLIKVFDIKREEALQLA 380 >ref|NP_001234728.1| ISPH protein [Solanum lycopersicum] gi|262176919|gb|ACY27516.1| ISPH protein [Solanum lycopersicum] Length = 461 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED LIKVFDIKREEALQ+A Sbjct: 430 GVTSGASTPDKVVEDVLIKVFDIKREEALQLA 461 >ref|XP_002313816.1| chloroplast biogenesis family protein [Populus trichocarpa] gi|222850224|gb|EEE87771.1| chloroplast biogenesis family protein [Populus trichocarpa] Length = 460 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKR+EALQ+A Sbjct: 429 GVTSGASTPDKVVEDALIKVFDIKRDEALQVA 460 >gb|ACD70402.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [Populus trichocarpa] Length = 426 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVEDALIKVFDIKR+EALQ+A Sbjct: 395 GVTSGASTPDKVVEDALIKVFDIKRDEALQVA 426 >ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Vitis vinifera] Length = 465 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED LIKVFDIKREEALQ+A Sbjct: 434 GVTSGASTPDKVVEDVLIKVFDIKREEALQLA 465 >ref|XP_010254975.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic [Nelumbo nucifera] Length = 462 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED LIKVFDIKREEALQ+A Sbjct: 431 GVTSGASTPDKVVEDVLIKVFDIKREEALQIA 462 >gb|ABI30631.1| 1-hydroxy-2-methyl-butenyl 4-diphosphate reductase [Catharanthus roseus] Length = 462 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 402 GVTSGASTPDKVVEDALIKVFDIKREEALQMA 307 GVTSGASTPDKVVED L+KVFDIKREEALQ+A Sbjct: 431 GVTSGASTPDKVVEDVLVKVFDIKREEALQLA 462