BLASTX nr result
ID: Forsythia21_contig00013491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00013491 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ71711.1| 60S ribosomal protein L30 [Aureobasidium namibiae... 87 6e-15 gb|KEQ61717.1| 60S ribosomal protein L30 [Aureobasidium melanoge... 87 6e-15 gb|KEQ99398.1| hypothetical protein AUEXF2481DRAFT_906 [Aureobas... 81 2e-13 ref|XP_001594073.1| 60S ribosomal protein L30 [Sclerotinia scler... 80 4e-13 gb|KIW15684.1| 60S ribosomal protein L30 [Exophiala spinifera] g... 80 7e-13 dbj|GAM85750.1| hypothetical protein ANO11243_037580 [fungal sp.... 80 7e-13 gb|KKY24349.1| putative 60s ribosomal protein l30 [Phaeomoniella... 79 1e-12 gb|KIV90500.1| 60S ribosomal protein [Exophiala mesophila] 79 1e-12 gb|KIV80993.1| 60S ribosomal protein L30 [Exophiala sideris] 79 1e-12 ref|XP_007785634.1| 60S ribosomal protein L30-1 [Endocarpon pusi... 79 1e-12 ref|XP_007779198.1| 60S ribosomal protein L30 [Coniosporium apol... 79 1e-12 gb|KIW49829.1| 60S ribosomal protein L30 [Exophiala xenobiotica] 79 2e-12 gb|KEF59634.1| 60S ribosomal protein L30 [Exophiala aquamarina C... 79 2e-12 ref|XP_007730693.1| 60S ribosomal protein L30 [Capronia epimyces... 79 2e-12 ref|XP_007742638.1| 60S ribosomal protein L30 [Cladophialophora ... 79 2e-12 ref|XP_008722038.1| 60S ribosomal protein L30 [Cladophialophora ... 79 2e-12 gb|EKG17776.1| Ribosomal protein L30e [Macrophomina phaseolina MS6] 79 2e-12 ref|XP_007719596.1| 60S ribosomal protein L30 [Capronia coronata... 79 2e-12 ref|XP_001395556.1| 60S ribosomal protein L30 [Aspergillus niger... 79 2e-12 ref|XP_001826354.1| 60S ribosomal protein L30 [Aspergillus oryza... 78 2e-12 >gb|KEQ71711.1| 60S ribosomal protein L30 [Aureobasidium namibiae CBS 147.97] gi|662532588|gb|KEQ89960.1| 60S ribosomal protein L30 [Aureobasidium pullulans EXF-150] Length = 108 Score = 86.7 bits (213), Expect = 6e-15 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -1 Query: 140 MAPKKTKTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKKTKTSDSINSRLALVMKSGKVTLGYKST+KA+RSGKAKLIII Sbjct: 1 MAPKKTKTSDSINSRLALVMKSGKVTLGYKSTIKAIRSGKAKLIII 46 >gb|KEQ61717.1| 60S ribosomal protein L30 [Aureobasidium melanogenum CBS 110374] Length = 108 Score = 86.7 bits (213), Expect = 6e-15 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -1 Query: 140 MAPKKTKTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKKTKTSDSINSRLALVMKSGKVTLGYKST+KA+RSGKAKLIII Sbjct: 1 MAPKKTKTSDSINSRLALVMKSGKVTLGYKSTIKAIRSGKAKLIII 46 >gb|KEQ99398.1| hypothetical protein AUEXF2481DRAFT_906 [Aureobasidium subglaciale EXF-2481] Length = 109 Score = 81.3 bits (199), Expect = 2e-13 Identities = 44/47 (93%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAP-KKTKTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAP KKTKTSDSINSRLALVMKSGKVTLGYKSTLK +RSGKAKLIII Sbjct: 1 MAPNKKTKTSDSINSRLALVMKSGKVTLGYKSTLKVIRSGKAKLIII 47 >ref|XP_001594073.1| 60S ribosomal protein L30 [Sclerotinia sclerotiorum 1980 UF-70] gi|154703285|gb|EDO03024.1| hypothetical protein SS1G_05501 [Sclerotinia sclerotiorum 1980 UF-70] Length = 128 Score = 80.5 bits (197), Expect = 4e-13 Identities = 44/53 (83%), Positives = 47/53 (88%), Gaps = 3/53 (5%) Frame = -1 Query: 152 KSAEMAP---KKTKTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 K+AEMAP K KT+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 14 KTAEMAPATKKAKKTADSINSRLALVMKSGKVTLGYKSTLKQLRSGKAKLVII 66 >gb|KIW15684.1| 60S ribosomal protein L30 [Exophiala spinifera] gi|759268142|gb|KIW44662.1| 60S ribosomal protein L30 [Exophiala oligosperma] Length = 108 Score = 79.7 bits (195), Expect = 7e-13 Identities = 43/47 (91%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K TSDSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKAKKTSDSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVII 47 >dbj|GAM85750.1| hypothetical protein ANO11243_037580 [fungal sp. No.11243] Length = 109 Score = 79.7 bits (195), Expect = 7e-13 Identities = 43/47 (91%), Positives = 46/47 (97%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK+K T+DSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKLIII Sbjct: 1 MAPKKSKRTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLIII 47 >gb|KKY24349.1| putative 60s ribosomal protein l30 [Phaeomoniella chlamydospora] Length = 108 Score = 79.0 bits (193), Expect = 1e-12 Identities = 42/47 (89%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK+K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKSKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >gb|KIV90500.1| 60S ribosomal protein [Exophiala mesophila] Length = 109 Score = 79.0 bits (193), Expect = 1e-12 Identities = 42/47 (89%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK+K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKSKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >gb|KIV80993.1| 60S ribosomal protein L30 [Exophiala sideris] Length = 109 Score = 79.0 bits (193), Expect = 1e-12 Identities = 43/47 (91%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKLIII Sbjct: 1 MAPKKAKKTTDSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLIII 47 >ref|XP_007785634.1| 60S ribosomal protein L30-1 [Endocarpon pusillum Z07020] gi|539441925|gb|ERF77046.1| 60S ribosomal protein L30-1 [Endocarpon pusillum Z07020] Length = 99 Score = 79.0 bits (193), Expect = 1e-12 Identities = 42/47 (89%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK+LRSGKAKL+II Sbjct: 1 MAPKKAKKTADSINSRLALVMKSGKVTLGYKSTLKSLRSGKAKLVII 47 >ref|XP_007779198.1| 60S ribosomal protein L30 [Coniosporium apollinis CBS 100218] gi|494826854|gb|EON63881.1| 60S ribosomal protein L30 [Coniosporium apollinis CBS 100218] Length = 109 Score = 79.0 bits (193), Expect = 1e-12 Identities = 42/47 (89%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK+K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKSKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >gb|KIW49829.1| 60S ribosomal protein L30 [Exophiala xenobiotica] Length = 109 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKAKKTTDSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >gb|KEF59634.1| 60S ribosomal protein L30 [Exophiala aquamarina CBS 119918] Length = 109 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKAKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >ref|XP_007730693.1| 60S ribosomal protein L30 [Capronia epimyces CBS 606.96] gi|590014094|gb|EXJ89296.1| 60S ribosomal protein L30 [Capronia epimyces CBS 606.96] Length = 108 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKT-KTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK KT+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKARKTTDSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >ref|XP_007742638.1| 60S ribosomal protein L30 [Cladophialophora psammophila CBS 110553] gi|589989988|gb|EXJ72691.1| 60S ribosomal protein L30 [Cladophialophora psammophila CBS 110553] gi|759247952|gb|KIW24620.1| 60S ribosomal protein L30 [Cladophialophora immunda] gi|759302290|gb|KIW78697.1| 60S ribosomal protein L30 [Fonsecaea pedrosoi CBS 271.37] gi|759319744|gb|KIW96089.1| 60S ribosomal protein L30 [Cladophialophora bantiana CBS 173.52] gi|759329570|gb|KIX05897.1| 60S ribosomal protein L30 [Rhinocladiella mackenziei CBS 650.93] gi|761334779|gb|KIX96346.1| 60S ribosomal protein L30 [Fonsecaea multimorphosa CBS 102226] Length = 108 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKAKKTTDSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVII 47 >ref|XP_008722038.1| 60S ribosomal protein L30 [Cladophialophora carrionii CBS 160.54] gi|565938858|gb|ETI27964.1| 60S ribosomal protein L30 [Cladophialophora carrionii CBS 160.54] Length = 108 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKAKKTTDSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVII 47 >gb|EKG17776.1| Ribosomal protein L30e [Macrophomina phaseolina MS6] Length = 110 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKTK-TSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK K T+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKNKKTADSINSRLALVMKSGKVTLGYKSTLKTLRSGKAKLVII 47 >ref|XP_007719596.1| 60S ribosomal protein L30 [Capronia coronata CBS 617.96] gi|684169040|ref|XP_009158391.1| 60S ribosomal protein L30 [Exophiala dermatitidis NIH/UT8656] gi|378731471|gb|EHY57930.1| 60S ribosomal protein L30 [Exophiala dermatitidis NIH/UT8656] gi|590020170|gb|EXJ95367.1| 60S ribosomal protein L30 [Capronia coronata CBS 617.96] Length = 108 Score = 78.6 bits (192), Expect = 2e-12 Identities = 42/47 (89%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = -1 Query: 140 MAPKKT-KTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPKK KT+DSINSRLALVMKSGKVTLGYKSTLK LRSGKAKL+II Sbjct: 1 MAPKKARKTTDSINSRLALVMKSGKVTLGYKSTLKCLRSGKAKLVII 47 >ref|XP_001395556.1| 60S ribosomal protein L30 [Aspergillus niger CBS 513.88] gi|134080274|emb|CAK97177.1| unnamed protein product [Aspergillus niger] gi|350636901|gb|EHA25259.1| hypothetical protein ASPNIDRAFT_56702 [Aspergillus niger ATCC 1015] gi|358369886|dbj|GAA86499.1| 60S ribosomal protein L30-2 [Aspergillus kawachii IFO 4308] Length = 106 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 140 MAPKKTKTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPK KT D+INSRLALVMKSGKVTLGYKST+K LRSGKAKL+II Sbjct: 1 MAPKSKKTGDTINSRLALVMKSGKVTLGYKSTIKTLRSGKAKLVII 46 >ref|XP_001826354.1| 60S ribosomal protein L30 [Aspergillus oryzae RIB40] gi|238493609|ref|XP_002378041.1| 60S ribosomal protein L30 [Aspergillus flavus NRRL3357] gi|83775098|dbj|BAE65221.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220696535|gb|EED52877.1| 60S ribosomal protein L30, putative [Aspergillus flavus NRRL3357] gi|391869425|gb|EIT78623.1| 60S ribosomal protein [Aspergillus oryzae 3.042] gi|635510540|gb|KDE82469.1| 60S ribosomal protein [Aspergillus oryzae 100-8] gi|768705469|gb|KJJ32218.1| Ribosomal protein L7AeL30eS12eGadd45 family protein [Aspergillus flavus AF70] Length = 106 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 140 MAPKKTKTSDSINSRLALVMKSGKVTLGYKSTLKALRSGKAKLIII 3 MAPK K +DSINSRLALVMKSGKVTLGYKST+K LRSGKAKL+II Sbjct: 1 MAPKSKKNADSINSRLALVMKSGKVTLGYKSTIKTLRSGKAKLVII 46