BLASTX nr result
ID: Forsythia21_contig00012217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00012217 (400 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009802766.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 106 5e-21 ref|XP_009596425.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 106 5e-21 ref|NP_001234269.1| UDP-sulfoquinovose synthase [Solanum lycoper... 106 5e-21 ref|XP_006367838.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 106 5e-21 ref|XP_011098411.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 106 7e-21 ref|XP_011098347.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 106 7e-21 ref|XP_009362003.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 106 7e-21 ref|XP_012857936.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 105 1e-20 ref|XP_008393635.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 105 2e-20 emb|CDP08269.1| unnamed protein product [Coffea canephora] 104 2e-20 gb|KDO80122.1| hypothetical protein CISIN_1g0117071mg, partial [... 104 3e-20 ref|XP_006475915.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 104 3e-20 ref|XP_006450855.1| hypothetical protein CICLE_v10008149mg [Citr... 104 3e-20 gb|ACZ51244.1| UDP-sulfoquinovose synthase [Arachis hypogaea] 104 3e-20 gb|KGN55335.1| hypothetical protein Csa_4G646090 [Cucumis sativus] 103 3e-20 ref|XP_008452725.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 103 3e-20 ref|XP_002516429.1| UDP-sulfoquinovose synthase, putative [Ricin... 103 3e-20 gb|AHL84160.1| UDP-sulfoquinovose synthase [Nicotiana tabacum] 103 3e-20 ref|XP_004141317.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 103 3e-20 ref|XP_012077275.1| PREDICTED: UDP-sulfoquinovose synthase, chlo... 103 4e-20 >ref|XP_009802766.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Nicotiana sylvestris] gi|698515775|ref|XP_009802767.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Nicotiana sylvestris] Length = 481 Score = 106 bits (265), Expect = 5e-21 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PH+LSDS+LDSLLNFA+QYKDRV+TKQ+MP+V W+KIGAKPKTVA Sbjct: 422 YNAKHTKLIELGLQPHLLSDSLLDSLLNFAVQYKDRVDTKQIMPSVSWKKIGAKPKTVA 480 >ref|XP_009596425.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Nicotiana tomentosiformis] gi|697174986|ref|XP_009596427.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Nicotiana tomentosiformis] gi|697174988|ref|XP_009596428.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Nicotiana tomentosiformis] Length = 481 Score = 106 bits (265), Expect = 5e-21 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PH+LSDS+LDSLLNFA+QYKDRV+TKQ+MP+V W+KIGAKPKTVA Sbjct: 422 YNAKHTKLIELGLQPHLLSDSLLDSLLNFAVQYKDRVDTKQIMPSVSWKKIGAKPKTVA 480 >ref|NP_001234269.1| UDP-sulfoquinovose synthase [Solanum lycopersicum] gi|723721831|ref|XP_010324955.1| PREDICTED: UDP-sulfoquinovose synthase isoform X1 [Solanum lycopersicum] gi|224579299|gb|ACN58227.1| UDP-sulfoquinovose synthase [Solanum lycopersicum] Length = 480 Score = 106 bits (265), Expect = 5e-21 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PH+LSDS+LDSLLNFA+QYKDRV+TKQ+MP+V W+KIGAKPKTVA Sbjct: 421 YNAKHTKLIELGLQPHLLSDSLLDSLLNFAVQYKDRVDTKQIMPSVSWKKIGAKPKTVA 479 >ref|XP_006367838.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565404855|ref|XP_006367839.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 481 Score = 106 bits (265), Expect = 5e-21 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PH+LSDS+LDSLLNFA+QYKDRV+TKQ+MP+V W+KIGAKPKTVA Sbjct: 422 YNAKHTKLIELGLQPHLLSDSLLDSLLNFAVQYKDRVDTKQIMPSVSWKKIGAKPKTVA 480 >ref|XP_011098411.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic isoform X2 [Sesamum indicum] gi|747040787|ref|XP_011098482.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic isoform X2 [Sesamum indicum] Length = 482 Score = 106 bits (264), Expect = 7e-21 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KLVELGLKPH+LSDS+LDSLLNFA+QYKDR+++KQ+MP+V WRKIG KPKTVA Sbjct: 423 YNAKHTKLVELGLKPHLLSDSLLDSLLNFAVQYKDRIDSKQIMPSVSWRKIGVKPKTVA 481 >ref|XP_011098347.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic isoform X1 [Sesamum indicum] Length = 508 Score = 106 bits (264), Expect = 7e-21 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KLVELGLKPH+LSDS+LDSLLNFA+QYKDR+++KQ+MP+V WRKIG KPKTVA Sbjct: 449 YNAKHTKLVELGLKPHLLSDSLLDSLLNFAVQYKDRIDSKQIMPSVSWRKIGVKPKTVA 507 >ref|XP_009362003.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Pyrus x bretschneideri] Length = 483 Score = 106 bits (264), Expect = 7e-21 Identities = 48/58 (82%), Positives = 56/58 (96%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTV 226 YNAKH KL+ELGLKPH+LSDS+LDSLLNFAI+YKDR++TKQ+MP+V WRKIGAKPKTV Sbjct: 424 YNAKHTKLIELGLKPHLLSDSLLDSLLNFAIKYKDRIDTKQIMPSVSWRKIGAKPKTV 481 >ref|XP_012857936.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Erythranthe guttatus] gi|604300534|gb|EYU20352.1| hypothetical protein MIMGU_mgv1a005410mg [Erythranthe guttata] Length = 484 Score = 105 bits (262), Expect = 1e-20 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KLVELGLKPH+LSDS++DSLLNF +QYKDRV+TKQ+MP+V WRKIG KPKT+A Sbjct: 425 YNAKHTKLVELGLKPHLLSDSLIDSLLNFTVQYKDRVDTKQIMPSVSWRKIGVKPKTIA 483 >ref|XP_008393635.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Malus domestica] Length = 483 Score = 105 bits (261), Expect = 2e-20 Identities = 47/58 (81%), Positives = 56/58 (96%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTV 226 YNAKH KL+ELGLKPH+LSDS+LDSLLNFA++YKDRV+TKQ+MP+V WRK+GAKPKTV Sbjct: 424 YNAKHTKLIELGLKPHLLSDSLLDSLLNFAVRYKDRVDTKQIMPSVSWRKMGAKPKTV 481 >emb|CDP08269.1| unnamed protein product [Coffea canephora] Length = 484 Score = 104 bits (260), Expect = 2e-20 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVAV 220 YNAKH KL+ELGLKPH+LSD++LDSLLNFAI+YKDRV+ KQ+MP+V WRKIG KPKTVAV Sbjct: 425 YNAKHTKLIELGLKPHLLSDALLDSLLNFAIKYKDRVDPKQIMPSVSWRKIGVKPKTVAV 484 >gb|KDO80122.1| hypothetical protein CISIN_1g0117071mg, partial [Citrus sinensis] gi|641861435|gb|KDO80123.1| hypothetical protein CISIN_1g0117071mg, partial [Citrus sinensis] Length = 133 Score = 104 bits (259), Expect = 3e-20 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PHILSDS+LDSLLNFAIQ+KDRV++KQ+MP+V WRKIG KPKTVA Sbjct: 74 YNAKHTKLIELGLQPHILSDSLLDSLLNFAIQFKDRVDSKQIMPSVSWRKIGTKPKTVA 132 >ref|XP_006475915.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic-like isoform X1 [Citrus sinensis] gi|568844063|ref|XP_006475916.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic-like isoform X2 [Citrus sinensis] Length = 479 Score = 104 bits (259), Expect = 3e-20 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PHILSDS+LDSLLNFAIQ+KDRV++KQ+MP+V WRKIG KPKTVA Sbjct: 420 YNAKHTKLIELGLQPHILSDSLLDSLLNFAIQFKDRVDSKQIMPSVSWRKIGTKPKTVA 478 >ref|XP_006450855.1| hypothetical protein CICLE_v10008149mg [Citrus clementina] gi|557554081|gb|ESR64095.1| hypothetical protein CICLE_v10008149mg [Citrus clementina] Length = 479 Score = 104 bits (259), Expect = 3e-20 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGL+PHILSDS+LDSLLNFAIQ+KDRV++KQ+MP+V WRKIG KPKTVA Sbjct: 420 YNAKHTKLIELGLQPHILSDSLLDSLLNFAIQFKDRVDSKQIMPSVSWRKIGTKPKTVA 478 >gb|ACZ51244.1| UDP-sulfoquinovose synthase [Arachis hypogaea] Length = 476 Score = 104 bits (259), Expect = 3e-20 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTV 226 YNAKH KLVELGLKPH+LSDS+LDSLLNFAIQYKDRV+ KQ+MP++ WRKIG KPKTV Sbjct: 417 YNAKHTKLVELGLKPHLLSDSLLDSLLNFAIQYKDRVDKKQIMPSISWRKIGVKPKTV 474 >gb|KGN55335.1| hypothetical protein Csa_4G646090 [Cucumis sativus] Length = 460 Score = 103 bits (258), Expect = 3e-20 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGLKPH+LSDS+LDS+LNFAI+YKDRV+TKQ+MP+V WRKIG KP+T+A Sbjct: 401 YNAKHTKLIELGLKPHLLSDSLLDSVLNFAIKYKDRVDTKQIMPSVSWRKIGVKPRTIA 459 >ref|XP_008452725.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Cucumis melo] Length = 483 Score = 103 bits (258), Expect = 3e-20 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGLKPH+LSDS+LDS+LNFAI+YKDRV+TKQ+MP+V WRKIG KP+T+A Sbjct: 424 YNAKHTKLIELGLKPHLLSDSLLDSVLNFAIKYKDRVDTKQIMPSVSWRKIGVKPRTIA 482 >ref|XP_002516429.1| UDP-sulfoquinovose synthase, putative [Ricinus communis] gi|223544249|gb|EEF45770.1| UDP-sulfoquinovose synthase, putative [Ricinus communis] Length = 481 Score = 103 bits (258), Expect = 3e-20 Identities = 47/59 (79%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGLKPH+LSDS+LDSLLNFAI++KDRV+TKQ+MP+V W+KIG KPKTVA Sbjct: 422 YNAKHTKLIELGLKPHLLSDSLLDSLLNFAIKFKDRVDTKQIMPSVSWKKIGVKPKTVA 480 >gb|AHL84160.1| UDP-sulfoquinovose synthase [Nicotiana tabacum] Length = 481 Score = 103 bits (258), Expect = 3e-20 Identities = 47/59 (79%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+E GL+PH+LSDS+LDSLLNFA+QYKDRV+TKQ+MP+V W+KIGAKPKTVA Sbjct: 422 YNAKHTKLIEPGLQPHLLSDSLLDSLLNFAVQYKDRVDTKQIMPSVSWKKIGAKPKTVA 480 >ref|XP_004141317.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Cucumis sativus] Length = 483 Score = 103 bits (258), Expect = 3e-20 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGLKPH+LSDS+LDS+LNFAI+YKDRV+TKQ+MP+V WRKIG KP+T+A Sbjct: 424 YNAKHTKLIELGLKPHLLSDSLLDSVLNFAIKYKDRVDTKQIMPSVSWRKIGVKPRTIA 482 >ref|XP_012077275.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Jatropha curcas] gi|802631369|ref|XP_012077276.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Jatropha curcas] gi|802631516|ref|XP_012077277.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Jatropha curcas] gi|802631519|ref|XP_012077278.1| PREDICTED: UDP-sulfoquinovose synthase, chloroplastic [Jatropha curcas] gi|643724890|gb|KDP34091.1| hypothetical protein JCGZ_07662 [Jatropha curcas] Length = 482 Score = 103 bits (257), Expect = 4e-20 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -2 Query: 399 YNAKHMKLVELGLKPHILSDSVLDSLLNFAIQYKDRVNTKQLMPNVLWRKIGAKPKTVA 223 YNAKH KL+ELGLKPH+LSDS+LDSLLNFAI++KDRV++KQ+MPNV WRK G KPKTVA Sbjct: 423 YNAKHTKLIELGLKPHLLSDSLLDSLLNFAIKFKDRVDSKQIMPNVSWRKTGVKPKTVA 481