BLASTX nr result
ID: Forsythia21_contig00011968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011968 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849123.1| PREDICTED: small ubiquitin-related modifier ... 125 8e-27 ref|XP_002866079.1| hypothetical protein ARALYDRAFT_918658 [Arab... 125 1e-26 ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis... 124 2e-26 ref|NP_001154779.1| small ubiquitin-related modifier 2 [Arabidop... 124 2e-26 ref|XP_009802320.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 ref|XP_009606082.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 gb|ACJ54186.1| SUMO [Nicotiana benthamiana] 124 2e-26 ref|XP_012841773.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 ref|XP_006346196.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 ref|XP_007146517.1| hypothetical protein PHAVU_006G047600g [Phas... 124 2e-26 ref|XP_006401487.1| hypothetical protein EUTSA_v10015094mg [Eutr... 124 2e-26 ref|XP_004513888.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 ref|XP_004251532.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 ref|XP_004244095.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 gb|AFK36023.1| unknown [Lotus japonicus] 124 2e-26 ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier ... 124 2e-26 ref|NP_001235208.1| uncharacterized protein LOC100500241 [Glycin... 124 2e-26 ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycin... 124 2e-26 gb|ABN05665.1| ubiquitin-like protein [Pisum sativum] 124 2e-26 gb|AAM21576.1|AF451278_1 ubiquitin-like protein SMT3 [Phaseolus ... 124 2e-26 >ref|XP_012849123.1| PREDICTED: small ubiquitin-related modifier 1-like [Erythranthe guttatus] gi|604314662|gb|EYU27368.1| hypothetical protein MIMGU_mgv1a017044mg [Erythranthe guttata] Length = 96 Score = 125 bits (315), Expect = 8e-27 Identities = 60/64 (93%), Positives = 63/64 (98%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTG Sbjct: 32 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTG 91 Query: 40 GFAA 29 G+A+ Sbjct: 92 GYAS 95 >ref|XP_002866079.1| hypothetical protein ARALYDRAFT_918658 [Arabidopsis lyrata subsp. lyrata] gi|297311914|gb|EFH42338.1| hypothetical protein ARALYDRAFT_918658 [Arabidopsis lyrata subsp. lyrata] Length = 102 Score = 125 bits (313), Expect = 1e-26 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 32 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 91 Query: 40 GFA 32 G A Sbjct: 92 GAA 94 >ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|75171511|sp|Q9FLP6.1|SUMO2_ARATH RecName: Full=Small ubiquitin-related modifier 2; Short=AtSUMO2 gi|9758113|dbj|BAB08585.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|19715611|gb|AAL91628.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21360423|gb|AAM47327.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21537401|gb|AAM61742.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|22652844|gb|AAN03846.1| small ubiquitin-like modifier 2 [Arabidopsis thaliana] gi|332009210|gb|AED96593.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Length = 103 Score = 124 bits (312), Expect = 2e-26 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 32 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 91 Query: 40 GFA 32 G A Sbjct: 92 GGA 94 >ref|NP_001154779.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|332009211|gb|AED96594.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Length = 116 Score = 124 bits (312), Expect = 2e-26 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 45 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 104 Query: 40 GFA 32 G A Sbjct: 105 GGA 107 >ref|XP_009802320.1| PREDICTED: small ubiquitin-related modifier 2 [Nicotiana sylvestris] Length = 96 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 33 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 92 Query: 40 G 38 G Sbjct: 93 G 93 >ref|XP_009606082.1| PREDICTED: small ubiquitin-related modifier 2 [Nicotiana tomentosiformis] Length = 96 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 33 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 92 Query: 40 G 38 G Sbjct: 93 G 93 >gb|ACJ54186.1| SUMO [Nicotiana benthamiana] Length = 96 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 33 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 92 Query: 40 G 38 G Sbjct: 93 G 93 >ref|XP_012841773.1| PREDICTED: small ubiquitin-related modifier 2 [Erythranthe guttatus] gi|604328000|gb|EYU33668.1| hypothetical protein MIMGU_mgv1a017022mg [Erythranthe guttata] Length = 96 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 32 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 91 Query: 40 G 38 G Sbjct: 92 G 92 >ref|XP_006346196.1| PREDICTED: small ubiquitin-related modifier 2-like [Solanum tuberosum] Length = 99 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 36 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 95 Query: 40 G 38 G Sbjct: 96 G 96 >ref|XP_007146517.1| hypothetical protein PHAVU_006G047600g [Phaseolus vulgaris] gi|561019740|gb|ESW18511.1| hypothetical protein PHAVU_006G047600g [Phaseolus vulgaris] Length = 100 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 37 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 96 Query: 40 G 38 G Sbjct: 97 G 97 >ref|XP_006401487.1| hypothetical protein EUTSA_v10015094mg [Eutrema salsugineum] gi|557102577|gb|ESQ42940.1| hypothetical protein EUTSA_v10015094mg [Eutrema salsugineum] Length = 104 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 34 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 93 Query: 40 G 38 G Sbjct: 94 G 94 >ref|XP_004513888.1| PREDICTED: small ubiquitin-related modifier 1-like [Cicer arietinum] Length = 100 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 37 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 96 Query: 40 G 38 G Sbjct: 97 G 97 >ref|XP_004251532.1| PREDICTED: small ubiquitin-related modifier 1 [Solanum lycopersicum] Length = 99 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 36 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 95 Query: 40 G 38 G Sbjct: 96 G 96 >ref|XP_004244095.1| PREDICTED: small ubiquitin-related modifier 1 [Solanum lycopersicum] Length = 99 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 36 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 95 Query: 40 G 38 G Sbjct: 96 G 96 >gb|AFK36023.1| unknown [Lotus japonicus] Length = 102 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 39 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 98 Query: 40 G 38 G Sbjct: 99 G 99 >ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier 2-like [Glycine max] gi|734344967|gb|KHN10571.1| Small ubiquitin-related modifier 2 [Glycine soja] Length = 114 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 38 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 97 Query: 40 G 38 G Sbjct: 98 G 98 >ref|NP_001235208.1| uncharacterized protein LOC100500241 [Glycine max] gi|255629810|gb|ACU15255.1| unknown [Glycine max] Length = 99 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 36 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 95 Query: 40 G 38 G Sbjct: 96 G 96 >ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycine max] gi|255626371|gb|ACU13530.1| unknown [Glycine max] gi|734346113|gb|KHN10987.1| Small ubiquitin-related modifier 2 [Glycine soja] Length = 103 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 38 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 97 Query: 40 G 38 G Sbjct: 98 G 98 >gb|ABN05665.1| ubiquitin-like protein [Pisum sativum] Length = 94 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 31 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 90 Query: 40 G 38 G Sbjct: 91 G 91 >gb|AAM21576.1|AF451278_1 ubiquitin-like protein SMT3 [Phaseolus vulgaris] Length = 89 Score = 124 bits (311), Expect = 2e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 220 RIKRSTQLKKLMNAYCERQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 41 RIKRSTQLKKLMNAYC+RQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG Sbjct: 26 RIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTG 85 Query: 40 G 38 G Sbjct: 86 G 86