BLASTX nr result
ID: Forsythia21_contig00011872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011872 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084148.1| PREDICTED: uncharacterized protein LOC105166... 57 4e-06 >ref|XP_011084148.1| PREDICTED: uncharacterized protein LOC105166476 [Sesamum indicum] Length = 388 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 333 DTLNASDHFTIEPLPGLDTIMEELLQEDGYD 241 D LNASDHF IEPLPGLDTI+EELL+EDG D Sbjct: 290 DALNASDHFDIEPLPGLDTIVEELLKEDGID 320