BLASTX nr result
ID: Forsythia21_contig00011775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011775 (272 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFI47928.1| terpene synthase 3 [Olea europaea] 90 7e-16 >gb|AFI47928.1| terpene synthase 3 [Olea europaea] Length = 609 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/81 (55%), Positives = 59/81 (72%) Frame = -3 Query: 243 MAHIVQLLPLGSSFIQNLPKQIVRGAIFNVEQRYRICCVANEQTYYLNTNKRSNYYKPSF 64 MA + LLPLGSSFI+NLPK+ N E+R+RI CVANEQ L+TN+ S YYKPS Sbjct: 1 MALTIFLLPLGSSFIRNLPKRPRIRPFGNTERRWRIHCVANEQAKNLSTNQHSGYYKPSS 60 Query: 63 WSHDFIMSLGDNIEMEVPKES 1 W+H+F+MSL ++ +VPK+S Sbjct: 61 WTHEFVMSLMNDSGKKVPKDS 81