BLASTX nr result
ID: Forsythia21_contig00011730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011730 (806 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515068.1| conserved hypothetical protein [Ricinus comm... 60 1e-06 gb|KCW59258.1| hypothetical protein EUGRSUZ_H01935 [Eucalyptus g... 59 3e-06 gb|KCW59259.1| hypothetical protein EUGRSUZ_H01937 [Eucalyptus g... 59 4e-06 ref|XP_010070464.1| PREDICTED: uncharacterized protein LOC104457... 58 8e-06 >ref|XP_002515068.1| conserved hypothetical protein [Ricinus communis] gi|223545548|gb|EEF47052.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 60.5 bits (145), Expect = 1e-06 Identities = 41/98 (41%), Positives = 55/98 (56%), Gaps = 9/98 (9%) Frame = -1 Query: 563 MGNWCGKKQVVQPDLDVEQPGRSSIMRVNVRMRVRELQELMEKVEKDGGNGIDADTKLGR 384 MGN G+KQVV P +E +R+ VRM R+L+E M +V+ G D++LGR Sbjct: 1 MGNCLGRKQVVHP---LEHSTSDYKLRIKVRMSARQLKEFMSRVDLRKG-----DSELGR 52 Query: 383 LILRECLDGRLQAPAV---------KYINQTSLPTIKE 297 ++L+ECLDGRL A V +Y N L TIKE Sbjct: 53 VVLQECLDGRLTARVVGRQDSVLASEYAN--GLATIKE 88 >gb|KCW59258.1| hypothetical protein EUGRSUZ_H01935 [Eucalyptus grandis] Length = 85 Score = 59.3 bits (142), Expect = 3e-06 Identities = 38/76 (50%), Positives = 46/76 (60%) Frame = -1 Query: 563 MGNWCGKKQVVQPDLDVEQPGRSSIMRVNVRMRVRELQELMEKVEKDGGNGIDADTKLGR 384 MGNW GKK VQP QP +RV VRM +L++LM +V+ G G +LG Sbjct: 1 MGNWLGKKAQVQPRA---QPRPH--VRVKVRMTRTQLRKLMSRVDPSRGYG-----ELGP 50 Query: 383 LILRECLDGRLQAPAV 336 LILRECL+GRL AP V Sbjct: 51 LILRECLEGRLLAPVV 66 >gb|KCW59259.1| hypothetical protein EUGRSUZ_H01937 [Eucalyptus grandis] Length = 83 Score = 58.9 bits (141), Expect = 4e-06 Identities = 36/76 (47%), Positives = 44/76 (57%) Frame = -1 Query: 563 MGNWCGKKQVVQPDLDVEQPGRSSIMRVNVRMRVRELQELMEKVEKDGGNGIDADTKLGR 384 MGNW GKK V P PG +RV VRM +L+ELM +V+ D +LG Sbjct: 1 MGNWLGKKAQVHPRAQ-PSPG----VRVKVRMTRTQLRELMSRVDPSR-----RDVELGP 50 Query: 383 LILRECLDGRLQAPAV 336 LILRECL+GRL AP + Sbjct: 51 LILRECLEGRLPAPVI 66 >ref|XP_010070464.1| PREDICTED: uncharacterized protein LOC104457226 [Eucalyptus grandis] Length = 81 Score = 57.8 bits (138), Expect = 8e-06 Identities = 37/76 (48%), Positives = 45/76 (59%) Frame = -1 Query: 563 MGNWCGKKQVVQPDLDVEQPGRSSIMRVNVRMRVRELQELMEKVEKDGGNGIDADTKLGR 384 MGNW GKK V P QP +RV VRM +L+ELM +V+ G+ +LG Sbjct: 1 MGNWLGKKPQVHPRA---QPRPH--VRVKVRMTRTQLRELMSRVDPSRGH-----RELGP 50 Query: 383 LILRECLDGRLQAPAV 336 LILRECL+GRL AP V Sbjct: 51 LILRECLEGRLPAPVV 66