BLASTX nr result
ID: Forsythia21_contig00011710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011710 (506 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075460.1| PREDICTED: mitotic-spindle organizing protei... 110 3e-22 ref|XP_010673057.1| PREDICTED: mitotic-spindle organizing protei... 104 3e-20 ref|XP_009613108.1| PREDICTED: mitotic-spindle organizing protei... 103 6e-20 ref|XP_009803058.1| PREDICTED: mitotic-spindle organizing protei... 102 8e-20 emb|CDP14679.1| unnamed protein product [Coffea canephora] 102 1e-19 ref|XP_004235364.1| PREDICTED: mitotic-spindle organizing protei... 102 1e-19 ref|XP_008441751.1| PREDICTED: mitotic-spindle organizing protei... 102 1e-19 gb|KCW47917.1| hypothetical protein EUGRSUZ_K01650, partial [Euc... 102 1e-19 ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protei... 102 1e-19 ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protei... 102 1e-19 ref|XP_009610722.1| PREDICTED: mitotic-spindle organizing protei... 101 2e-19 gb|KDO61916.1| hypothetical protein CISIN_1g0405721mg, partial [... 101 2e-19 ref|XP_011649034.1| PREDICTED: mitotic-spindle organizing protei... 101 2e-19 ref|XP_002323237.1| hypothetical protein POPTR_0016s03370g [Popu... 101 2e-19 ref|XP_012440309.1| PREDICTED: mitotic-spindle organizing protei... 101 2e-19 gb|KJB53006.1| hypothetical protein B456_008G288400 [Gossypium r... 101 2e-19 ref|XP_012477653.1| PREDICTED: mitotic-spindle organizing protei... 100 3e-19 ref|XP_012477649.1| PREDICTED: mitotic-spindle organizing protei... 100 3e-19 ref|XP_012477658.1| PREDICTED: mitotic-spindle organizing protei... 100 3e-19 ref|XP_009787685.1| PREDICTED: mitotic-spindle organizing protei... 100 3e-19 >ref|XP_011075460.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Sesamum indicum] gi|747058252|ref|XP_011075461.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Sesamum indicum] Length = 72 Score = 110 bits (276), Expect = 3e-22 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMG+NPESLAA+VKELRRE Sbjct: 1 MDPEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGLNPESLAAVVKELRRE 58 >ref|XP_010673057.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Beta vulgaris subsp. vulgaris] gi|870864078|gb|KMT15211.1| hypothetical protein BVRB_3g063220 [Beta vulgaris subsp. vulgaris] Length = 74 Score = 104 bits (259), Expect = 3e-20 Identities = 50/58 (86%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MDSEAARTARDSLEL F MSNILDTGLDRHTLS+LIALC++G+NPE+LAA+VKELRRE Sbjct: 1 MDSEAARTARDSLELAFQMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVVKELRRE 58 >ref|XP_009613108.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana tomentosiformis] gi|697118370|ref|XP_009613109.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana tomentosiformis] gi|697118372|ref|XP_009613110.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana tomentosiformis] gi|697118374|ref|XP_009613111.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana tomentosiformis] Length = 74 Score = 103 bits (256), Expect = 6e-20 Identities = 48/58 (82%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTARDSLELVFHMSNILDTGLDRHTLS+LI+LC++G NPE+LAA++KELR+E Sbjct: 1 MDPEAARTARDSLELVFHMSNILDTGLDRHTLSVLISLCDLGFNPEALAAVIKELRQE 58 >ref|XP_009803058.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana sylvestris] gi|698516358|ref|XP_009803059.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana sylvestris] gi|698516360|ref|XP_009803060.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana sylvestris] gi|698516362|ref|XP_009803061.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Nicotiana sylvestris] Length = 73 Score = 102 bits (255), Expect = 8e-20 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAAR ARDSL+LVFHMSNILDTGLDRHTLS+LIALCEMG +PE+LAA+VKELRRE Sbjct: 1 MDPEAARHARDSLDLVFHMSNILDTGLDRHTLSVLIALCEMGFSPEALAAVVKELRRE 58 >emb|CDP14679.1| unnamed protein product [Coffea canephora] Length = 131 Score = 102 bits (254), Expect = 1e-19 Identities = 50/58 (86%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+LVFHMSNIL+TGLDRHTLSILIALCEMG+NPE+LAA+VKELR E Sbjct: 52 MDPEAARTARESLDLVFHMSNILETGLDRHTLSILIALCEMGLNPEALAAVVKELRWE 109 >ref|XP_004235364.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Solanum lycopersicum] gi|565361754|ref|XP_006347618.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Solanum tuberosum] Length = 76 Score = 102 bits (254), Expect = 1e-19 Identities = 47/58 (81%), Positives = 57/58 (98%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTARDSLELVFHMSNILDTGLDRH+LS+LI+LC++G+NPE+LAA++KELR+E Sbjct: 1 MDPEAARTARDSLELVFHMSNILDTGLDRHSLSVLISLCDLGLNPEALAAVIKELRQE 58 >ref|XP_008441751.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] gi|659082268|ref|XP_008441752.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] gi|659082270|ref|XP_008441753.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] gi|659082272|ref|XP_008441754.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] gi|659082274|ref|XP_008441755.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] gi|659082276|ref|XP_008441756.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] gi|659082278|ref|XP_008441757.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis melo] Length = 71 Score = 102 bits (253), Expect = 1e-19 Identities = 46/58 (79%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSN+LD+G+DRHTLS+LIALC+MG+NPE+LAA+VKELRRE Sbjct: 1 MDQEAARTARESLDLAFHMSNVLDSGIDRHTLSVLIALCDMGVNPEALAAVVKELRRE 58 >gb|KCW47917.1| hypothetical protein EUGRSUZ_K01650, partial [Eucalyptus grandis] Length = 107 Score = 102 bits (253), Expect = 1e-19 Identities = 47/59 (79%), Positives = 56/59 (94%) Frame = -3 Query: 498 AMDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 AMD EAARTAR+SL+L FHMSNILDTGLDRHTLS+LIALC++G+NPE+LAA+V+EL RE Sbjct: 36 AMDQEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVVRELHRE 94 >ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Glycine max] gi|571434840|ref|XP_006573311.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Glycine max] gi|734326949|gb|KHN05647.1| Mitotic-spindle organizing protein 1B [Glycine soja] Length = 74 Score = 102 bits (253), Expect = 1e-19 Identities = 47/58 (81%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+LIALC++G+NPE+LAA+VKELR+E Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVVKELRKE 58 >ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protein 1B [Glycine max] gi|255633504|gb|ACU17110.1| unknown [Glycine max] Length = 73 Score = 102 bits (253), Expect = 1e-19 Identities = 47/58 (81%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+LIALC++G+NPE+LAA+VKELR+E Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVVKELRKE 58 >ref|XP_009610722.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Nicotiana tomentosiformis] gi|697095308|ref|XP_009610730.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Nicotiana tomentosiformis] Length = 73 Score = 101 bits (252), Expect = 2e-19 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD +AAR ARDSL+LVFHMSNILDTGLDRHTLS+LIALCEMG +PE+LAA+VKELRRE Sbjct: 1 MDPDAARHARDSLDLVFHMSNILDTGLDRHTLSVLIALCEMGFSPEALAAVVKELRRE 58 >gb|KDO61916.1| hypothetical protein CISIN_1g0405721mg, partial [Citrus sinensis] Length = 73 Score = 101 bits (252), Expect = 2e-19 Identities = 47/58 (81%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+LIALC++G+NPE+LAA+VKEL+RE Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVVKELQRE 58 >ref|XP_011649034.1| PREDICTED: mitotic-spindle organizing protein 1A-like [Cucumis sativus] gi|700206227|gb|KGN61346.1| hypothetical protein Csa_2G094370 [Cucumis sativus] Length = 71 Score = 101 bits (252), Expect = 2e-19 Identities = 46/58 (79%), Positives = 55/58 (94%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSN+LD G+DRHTLS+LIALC+MG+NPE+LAA+VKELRRE Sbjct: 1 MDQEAARTARESLDLAFHMSNVLDAGIDRHTLSVLIALCDMGVNPEALAAVVKELRRE 58 >ref|XP_002323237.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|566208464|ref|XP_006373698.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|566208466|ref|XP_006373699.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|118481729|gb|ABK92804.1| unknown [Populus trichocarpa] gi|222867867|gb|EEF04998.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|550320731|gb|ERP51495.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|550320732|gb|ERP51496.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] Length = 74 Score = 101 bits (252), Expect = 2e-19 Identities = 47/58 (81%), Positives = 55/58 (94%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAA+TARDSL L FHMSN+LDTGLDRHTLS+LIALC++G+NPE+LAA+VKELRRE Sbjct: 1 MDPEAAKTARDSLNLAFHMSNLLDTGLDRHTLSVLIALCDLGLNPEALAAVVKELRRE 58 >ref|XP_012440309.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Gossypium raimondii] gi|823215106|ref|XP_012440310.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Gossypium raimondii] Length = 73 Score = 101 bits (251), Expect = 2e-19 Identities = 47/58 (81%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+LIALC++G+NPE+LAA+VKEL+RE Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVVKELQRE 58 >gb|KJB53006.1| hypothetical protein B456_008G288400 [Gossypium raimondii] Length = 107 Score = 101 bits (251), Expect = 2e-19 Identities = 47/58 (81%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+LIALC++G+NPE+LAA+VKEL+RE Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVVKELQRE 58 >ref|XP_012477653.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Gossypium raimondii] Length = 81 Score = 100 bits (250), Expect = 3e-19 Identities = 46/58 (79%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+L+ALC++G+NPE+LAA+VKEL+RE Sbjct: 9 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLVALCDLGLNPEALAAVVKELQRE 66 >ref|XP_012477649.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Gossypium raimondii] Length = 82 Score = 100 bits (250), Expect = 3e-19 Identities = 46/58 (79%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+L+ALC++G+NPE+LAA+VKEL+RE Sbjct: 10 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLVALCDLGLNPEALAAVVKELQRE 67 >ref|XP_012477658.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X3 [Gossypium raimondii] gi|763741676|gb|KJB09175.1| hypothetical protein B456_001G127500 [Gossypium raimondii] Length = 80 Score = 100 bits (250), Expect = 3e-19 Identities = 46/58 (79%), Positives = 56/58 (96%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD EAARTAR+SL+L FHMSNILDTGLDRHTLS+L+ALC++G+NPE+LAA+VKEL+RE Sbjct: 8 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLVALCDLGLNPEALAAVVKELQRE 65 >ref|XP_009787685.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Nicotiana sylvestris] gi|698481377|ref|XP_009787686.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Nicotiana sylvestris] gi|698481380|ref|XP_009787687.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Nicotiana sylvestris] gi|698481384|ref|XP_009787688.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Nicotiana sylvestris] Length = 71 Score = 100 bits (250), Expect = 3e-19 Identities = 47/58 (81%), Positives = 55/58 (94%) Frame = -3 Query: 495 MDSEAARTARDSLELVFHMSNILDTGLDRHTLSILIALCEMGINPESLAAIVKELRRE 322 MD AARTARDSLELVFHMSNILDTGLDRHTLS+LI+LC++G NPE+LAA++KELR+E Sbjct: 1 MDPAAARTARDSLELVFHMSNILDTGLDRHTLSVLISLCDLGFNPEALAAVIKELRQE 58