BLASTX nr result
ID: Forsythia21_contig00011622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011622 (423 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247430.2| PREDICTED: thiamine pyrophosphokinase 1 isof... 70 7e-10 ref|XP_007050883.1| Thiamin pyrophosphokinase1 isoform 1 [Theobr... 69 1e-09 ref|XP_009781906.1| PREDICTED: thiamine pyrophosphokinase 2-like... 69 2e-09 ref|XP_010269524.1| PREDICTED: thiamine pyrophosphokinase 1 isof... 68 2e-09 ref|XP_009774386.1| PREDICTED: thiamine pyrophosphokinase 2-like... 68 3e-09 ref|XP_009774385.1| PREDICTED: thiamine pyrophosphokinase 2-like... 68 3e-09 ref|XP_009774384.1| PREDICTED: thiamine pyrophosphokinase 2-like... 68 3e-09 ref|XP_009598047.1| PREDICTED: thiamine pyrophosphokinase 2 isof... 68 3e-09 ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like... 67 4e-09 gb|KHG14968.1| Thiamin pyrophosphokinase 1 [Gossypium arboreum] 67 5e-09 ref|XP_010669808.1| PREDICTED: thiamine pyrophosphokinase 2-like... 66 8e-09 ref|XP_012082734.1| PREDICTED: thiamine pyrophosphokinase 1 isof... 65 2e-08 gb|KJB49947.1| hypothetical protein B456_008G146400 [Gossypium r... 64 3e-08 ref|XP_012438054.1| PREDICTED: thiamine pyrophosphokinase 1-like... 64 3e-08 gb|KJB49943.1| hypothetical protein B456_008G146400 [Gossypium r... 64 3e-08 gb|KHG16577.1| Thiamin pyrophosphokinase 1 [Gossypium arboreum] 64 3e-08 ref|XP_012473493.1| PREDICTED: thiamine pyrophosphokinase 1-like... 64 4e-08 gb|KJB22530.1| hypothetical protein B456_004G052600 [Gossypium r... 64 4e-08 ref|XP_012473495.1| PREDICTED: thiamine pyrophosphokinase 1-like... 64 4e-08 ref|XP_011079685.1| PREDICTED: thiamine pyrophosphokinase 1 [Ses... 64 4e-08 >ref|XP_004247430.2| PREDICTED: thiamine pyrophosphokinase 1 isoform X1 [Solanum lycopersicum] Length = 280 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M L HSSTFLLP+ PAD+G +L+Y+LV+LNQ LPKFTPLLW H Sbjct: 25 MSLTSHSSTFLLPNLPADDGPALTYALVILNQSLPKFTPLLWKH 68 >ref|XP_007050883.1| Thiamin pyrophosphokinase1 isoform 1 [Theobroma cacao] gi|508703144|gb|EOX95040.1| Thiamin pyrophosphokinase1 isoform 1 [Theobroma cacao] Length = 257 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSSTFLLP P+D+ SL+Y+LVVLNQ LP+FTPLLW H Sbjct: 1 MDLMHHSSTFLLPTIPSDHRPSLTYALVVLNQNLPRFTPLLWKH 44 >ref|XP_009781906.1| PREDICTED: thiamine pyrophosphokinase 2-like, partial [Nicotiana sylvestris] Length = 154 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M M HSSTFLLP+ P DNG +L+Y+LV+LNQ LP+FTPLLW H Sbjct: 1 MGTMSHSSTFLLPNLPTDNGPALTYALVILNQHLPRFTPLLWEH 44 >ref|XP_010269524.1| PREDICTED: thiamine pyrophosphokinase 1 isoform X1 [Nelumbo nucifera] Length = 258 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M+LM HSSTFLLP P D SL+Y+LVVLNQ LP+FTPLLW H Sbjct: 1 MELMSHSSTFLLPSIPVDGSPSLTYALVVLNQRLPRFTPLLWKH 44 >ref|XP_009774386.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X3 [Nicotiana sylvestris] Length = 127 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M M HSSTFLLP+ P DNG +L+Y+LV+LNQ LP+FTPLLW H Sbjct: 21 MGPMSHSSTFLLPNLPTDNGPALTYALVILNQRLPRFTPLLWEH 64 >ref|XP_009774385.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X2 [Nicotiana sylvestris] Length = 138 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M M HSSTFLLP+ P DNG +L+Y+LV+LNQ LP+FTPLLW H Sbjct: 1 MGPMSHSSTFLLPNLPTDNGPALTYALVILNQRLPRFTPLLWEH 44 >ref|XP_009774384.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X1 [Nicotiana sylvestris] Length = 158 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M M HSSTFLLP+ P DNG +L+Y+LV+LNQ LP+FTPLLW H Sbjct: 21 MGPMSHSSTFLLPNLPTDNGPALTYALVILNQRLPRFTPLLWEH 64 >ref|XP_009598047.1| PREDICTED: thiamine pyrophosphokinase 2 isoform X1 [Nicotiana tomentosiformis] Length = 256 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M ++ HSSTFLLP+ P DNG L+Y+LV+LNQ LP+FTPLLW H Sbjct: 1 MGMISHSSTFLLPNLPTDNGPDLTYALVILNQRLPRFTPLLWEH 44 >ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X1 [Solanum tuberosum] Length = 279 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M L HSSTFLLP+ P D+G +L+Y+LV+LNQ +PKFTPLLW H Sbjct: 24 MSLTSHSSTFLLPNLPTDDGPALTYALVILNQSIPKFTPLLWKH 67 >gb|KHG14968.1| Thiamin pyrophosphokinase 1 [Gossypium arboreum] Length = 258 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSSTFLLP P +G SL+Y+LVVLNQ LP+F PLLW H Sbjct: 1 MDLMHHSSTFLLPTIPLHHGPSLTYALVVLNQTLPRFAPLLWKH 44 >ref|XP_010669808.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X1 [Beta vulgaris subsp. vulgaris] gi|870866541|gb|KMT17500.1| hypothetical protein BVRB_2g037030 isoform A [Beta vulgaris subsp. vulgaris] Length = 258 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M++M HS+ FLLP P++ GFSL Y+LV+LNQ LP+FTPLLW H Sbjct: 1 MEVMHHSTAFLLPLIPSEQGFSLKYALVILNQRLPRFTPLLWEH 44 >ref|XP_012082734.1| PREDICTED: thiamine pyrophosphokinase 1 isoform X1 [Jatropha curcas] gi|643716515|gb|KDP28141.1| hypothetical protein JCGZ_13912 [Jatropha curcas] Length = 257 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSS+FLLP DN SL+Y+LVVLNQ LP+F PLLW H Sbjct: 1 MDLMTHSSSFLLPPVSTDNCSSLTYALVVLNQRLPRFAPLLWKH 44 >gb|KJB49947.1| hypothetical protein B456_008G146400 [Gossypium raimondii] Length = 234 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSS FLLP P SL+Y+L+VLNQ LP+FTPLLWNH Sbjct: 33 MDLMHHSSCFLLPTIPLQRRPSLTYALLVLNQNLPRFTPLLWNH 76 >ref|XP_012438054.1| PREDICTED: thiamine pyrophosphokinase 1-like isoform X1 [Gossypium raimondii] gi|763782874|gb|KJB49945.1| hypothetical protein B456_008G146400 [Gossypium raimondii] Length = 289 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSS FLLP P SL+Y+L+VLNQ LP+FTPLLWNH Sbjct: 33 MDLMHHSSCFLLPTIPLQRRPSLTYALLVLNQNLPRFTPLLWNH 76 >gb|KJB49943.1| hypothetical protein B456_008G146400 [Gossypium raimondii] Length = 255 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSS FLLP P SL+Y+L+VLNQ LP+FTPLLWNH Sbjct: 33 MDLMHHSSCFLLPTIPLQRRPSLTYALLVLNQNLPRFTPLLWNH 76 >gb|KHG16577.1| Thiamin pyrophosphokinase 1 [Gossypium arboreum] Length = 260 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSS FLLP P SL+Y+L+VLNQ LP+FTPLLWNH Sbjct: 4 MDLMHHSSCFLLPTIPLQRRPSLTYALLVLNQNLPRFTPLLWNH 47 >ref|XP_012473493.1| PREDICTED: thiamine pyrophosphokinase 1-like isoform X1 [Gossypium raimondii] Length = 258 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSSTFLLP P + SL+Y+LVVLNQ LP+F PLLW H Sbjct: 1 MDLMHHSSTFLLPTIPLHHRPSLTYALVVLNQTLPRFAPLLWKH 44 >gb|KJB22530.1| hypothetical protein B456_004G052600 [Gossypium raimondii] Length = 226 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSSTFLLP P + SL+Y+LVVLNQ LP+F PLLW H Sbjct: 1 MDLMHHSSTFLLPTIPLHHRPSLTYALVVLNQTLPRFAPLLWKH 44 >ref|XP_012473495.1| PREDICTED: thiamine pyrophosphokinase 1-like isoform X2 [Gossypium raimondii] gi|763755197|gb|KJB22528.1| hypothetical protein B456_004G052600 [Gossypium raimondii] Length = 257 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 MDLM HSSTFLLP P + SL+Y+LVVLNQ LP+F PLLW H Sbjct: 1 MDLMHHSSTFLLPTIPLHHRPSLTYALVVLNQTLPRFAPLLWKH 44 >ref|XP_011079685.1| PREDICTED: thiamine pyrophosphokinase 1 [Sesamum indicum] gi|747066038|ref|XP_011079686.1| PREDICTED: thiamine pyrophosphokinase 1 [Sesamum indicum] Length = 257 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -3 Query: 133 MDLMIHSSTFLLPDFPADNGFSLSYSLVVLNQPLPKFTPLLWNH 2 M++M HSS+FLLP+ ADNG SL+Y+L++LN+ LP+FTPLLW H Sbjct: 1 MEVMTHSSSFLLPNPSADNGPSLTYALLLLNRRLPRFTPLLWKH 44