BLASTX nr result
ID: Forsythia21_contig00011621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00011621 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012833112.1| PREDICTED: thiamine pyrophosphokinase 1 isof... 58 2e-06 ref|XP_012833104.1| PREDICTED: thiamine pyrophosphokinase 1 isof... 58 3e-06 >ref|XP_012833112.1| PREDICTED: thiamine pyrophosphokinase 1 isoform X2 [Erythranthe guttatus] Length = 217 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 99 RTARFRVCADGGANRLYDEFPQLFPDEDAFAIR 1 R A+ R+CADGGANRLYDE P LFPD+DA AIR Sbjct: 4 RAAQLRICADGGANRLYDELPLLFPDQDAIAIR 36 >ref|XP_012833104.1| PREDICTED: thiamine pyrophosphokinase 1 isoform X1 [Erythranthe guttatus] gi|604348528|gb|EYU46683.1| hypothetical protein MIMGU_mgv1a012265mg [Erythranthe guttata] Length = 256 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 108 ILCRTARFRVCADGGANRLYDEFPQLFPDEDAFAIR 1 +L + A+ R+CADGGANRLYDE P LFPD+DA AIR Sbjct: 40 LLWKHAQLRICADGGANRLYDELPLLFPDQDAIAIR 75