BLASTX nr result
ID: Forsythia21_contig00010551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00010551 (384 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614546.1| Cytochrome b559 subunit alpha [Medicago trun... 57 5e-06 gb|KJB09770.1| hypothetical protein B456_001G163700, partial [Go... 57 6e-06 >ref|XP_003614546.1| Cytochrome b559 subunit alpha [Medicago truncatula] gi|355515881|gb|AES97504.1| lumenal portion of cytochrome b559, alpha protein [Medicago truncatula] Length = 83 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/52 (61%), Positives = 34/52 (65%) Frame = +3 Query: 177 SFADIITRIRYWIIHNKTIPSLFTRPILRVIRQHEFCFLF*YRFGSPRPNEY 332 SFADIIT IRYWIIH+ TIPSLF L V + Y FGSPRPNEY Sbjct: 9 SFADIITSIRYWIIHSITIPSLFIAGWLFVSTGLAY-----YVFGSPRPNEY 55 >gb|KJB09770.1| hypothetical protein B456_001G163700, partial [Gossypium raimondii] Length = 107 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = +3 Query: 150 SLPLSPFSHSFADIITRIRYWIIHNKTIPSLFTRPILRVIRQHEFCFLF*YRFGSPRPNE 329 S+ S SFADI T IR W+IH+K IPSLFT+ I V Y FGSPRPNE Sbjct: 33 SMSGSTGERSFADIFTSIRDWVIHSKPIPSLFTQRIKGVS----------YSFGSPRPNE 82 Query: 330 Y 332 Y Sbjct: 83 Y 83