BLASTX nr result
ID: Forsythia21_contig00009983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00009983 (972 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836354.1| PREDICTED: prostatic spermine-binding protei... 64 1e-07 >ref|XP_012836354.1| PREDICTED: prostatic spermine-binding protein-like [Erythranthe guttatus] Length = 175 Score = 64.3 bits (155), Expect = 1e-07 Identities = 37/76 (48%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = -1 Query: 786 MEVGKFS--CCALRKQLMACSFVEVAVVHTLLAAQKSXXXXXXXXXXXLNDIDGLPNLVE 613 MEV K S L KQLM SF+E A V+T+ AA K+ LN DGLP+ + Sbjct: 1 MEVNKLSPDMAVLSKQLMVSSFLEAAAVNTVFAAHKTLVSLLMLAEAMLNAADGLPDWMA 60 Query: 612 KRFPMDELHRLEKPGP 565 KRFPM+EL R+EK GP Sbjct: 61 KRFPMEELRRVEKAGP 76