BLASTX nr result
ID: Forsythia21_contig00009971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00009971 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDY13963.1| BnaC09g38630D [Brassica napus] 61 3e-07 gb|KHN28457.1| Pollen-specific protein SF21, partial [Glycine soja] 57 4e-06 ref|XP_004245110.1| PREDICTED: pollen-specific protein SF21-like... 57 5e-06 gb|KHN30263.1| Pollen-specific protein SF21 [Glycine soja] 57 6e-06 gb|KHN16678.1| Pollen-specific protein SF21 [Glycine soja] 57 6e-06 gb|AFK48469.1| unknown [Medicago truncatula] 57 6e-06 ref|XP_002883979.1| ndr family protein [Arabidopsis lyrata subsp... 57 6e-06 ref|XP_012452616.1| PREDICTED: pollen-specific protein SF21 isof... 56 8e-06 ref|XP_010041425.1| PREDICTED: pollen-specific protein SF21-like... 56 8e-06 ref|XP_012857931.1| PREDICTED: pollen-specific protein SF21 [Ery... 56 8e-06 >emb|CDY13963.1| BnaC09g38630D [Brassica napus] Length = 97 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGVCK 267 SCFQGLF C EAVSL LHNF IYHIS PGH VC+ Sbjct: 64 SCFQGLFLCPEAVSLLLHNFCIYHISPPGHEVCR 97 >gb|KHN28457.1| Pollen-specific protein SF21, partial [Glycine soja] Length = 208 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGVCKLAN 258 SCFQGLF+C EA SL LHNF IYHIS PGH + AN Sbjct: 108 SCFQGLFFCPEAASLLLHNFCIYHISPPGHELGATAN 144 >ref|XP_004245110.1| PREDICTED: pollen-specific protein SF21-like [Solanum lycopersicum] Length = 347 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGH 279 SCFQGLFYC EA SL LHNF IYHIS PGH Sbjct: 56 SCFQGLFYCPEAFSLLLHNFCIYHISPPGH 85 >gb|KHN30263.1| Pollen-specific protein SF21 [Glycine soja] Length = 173 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGV 273 SCFQGLF+C EA SL LHNF IYHIS PGH V Sbjct: 50 SCFQGLFFCPEAASLLLHNFCIYHISPPGHEV 81 >gb|KHN16678.1| Pollen-specific protein SF21 [Glycine soja] Length = 328 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGV 273 SCFQGLF+C EA SL LHNF IYHIS PGH V Sbjct: 24 SCFQGLFFCPEAASLLLHNFCIYHISPPGHEV 55 >gb|AFK48469.1| unknown [Medicago truncatula] Length = 95 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGV 273 SCFQGLF+C EA SL LHNF IYHIS PGH V Sbjct: 56 SCFQGLFFCPEAASLLLHNFCIYHISPPGHEV 87 >ref|XP_002883979.1| ndr family protein [Arabidopsis lyrata subsp. lyrata] gi|297329819|gb|EFH60238.1| ndr family protein [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGV 273 SCFQGLF C EAVSL LHNF IYHIS PGH V Sbjct: 56 SCFQGLFLCPEAVSLLLHNFCIYHISPPGHEV 87 >ref|XP_012452616.1| PREDICTED: pollen-specific protein SF21 isoform X3 [Gossypium raimondii] Length = 351 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGVCKL 264 SCFQGLF+C EA SL LHNF IYHIS PGH +L Sbjct: 56 SCFQGLFFCPEAASLLLHNFCIYHISPPGHEFLQL 90 >ref|XP_010041425.1| PREDICTED: pollen-specific protein SF21-like isoform X1 [Eucalyptus grandis] Length = 356 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGHGVCKL 264 SCFQGLF+C +A SL LHNF IYHI PGH V +L Sbjct: 56 SCFQGLFFCPDAASLLLHNFCIYHIDAPGHEVLQL 90 >ref|XP_012857931.1| PREDICTED: pollen-specific protein SF21 [Erythranthe guttatus] gi|604300548|gb|EYU20366.1| hypothetical protein MIMGU_mgv1a009297mg [Erythranthe guttata] Length = 347 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 368 SCFQGLFYCLEAVSLFLHNFYIYHISLPGH 279 SCFQGLF+C EA+SL LHNF IYHIS PGH Sbjct: 56 SCFQGLFFCPEALSLLLHNFCIYHISPPGH 85