BLASTX nr result
ID: Forsythia21_contig00009134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00009134 (547 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001661400.1| ATPase subunit 6 [Cycas taitungensis] gi|166... 44 3e-07 >ref|YP_001661400.1| ATPase subunit 6 [Cycas taitungensis] gi|166706938|dbj|BAF98402.1| ATPase subunit 6 [Cycas taitungensis] Length = 255 Score = 43.5 bits (101), Expect(2) = 3e-07 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 179 YDFVLNLVNEQIGDLSGNVRQKFP 108 YDFV N VNEQIG LSGNV+QKFP Sbjct: 68 YDFVPNPVNEQIGGLSGNVKQKFP 91 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = -2 Query: 117 KVPPCISVVFTFSIFHNSQSMIPYTQSCSLFALSLVIGP 1 K PP ISV FT S+F N Q MIPY+ + + + + +GP Sbjct: 89 KFPPRISVTFTSSLFRNPQGMIPYSSTVTSHFI-ITLGP 126