BLASTX nr result
ID: Forsythia21_contig00009052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00009052 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO70212.1| hypothetical protein CISIN_1g042152mg [Citrus sin... 66 8e-09 ref|XP_006437820.1| hypothetical protein CICLE_v10033531mg [Citr... 66 8e-09 emb|CDP14584.1| unnamed protein product [Coffea canephora] 64 4e-08 ref|XP_011085296.1| PREDICTED: protein SRG1-like [Sesamum indicum] 64 5e-08 ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, p... 64 5e-08 emb|CDP21427.1| unnamed protein product [Coffea canephora] gi|66... 63 7e-08 ref|XP_011085301.1| PREDICTED: protein SRG1-like [Sesamum indicum] 63 9e-08 ref|XP_011085299.1| PREDICTED: protein SRG1-like [Sesamum indicum] 62 1e-07 ref|XP_010057215.1| PREDICTED: protein SRG1-like isoform X2 [Euc... 62 1e-07 ref|XP_010057213.1| PREDICTED: protein SRG1-like isoform X1 [Euc... 62 1e-07 emb|CAN70480.1| hypothetical protein VITISV_023586 [Vitis vinifera] 62 1e-07 gb|AJI44436.1| oxoglutarate-dependent dioxygenase 2 [Ocimum basi... 62 2e-07 gb|AJI44435.1| oxoglutarate-dependent flavone 7-O-demethylase [O... 62 2e-07 emb|CDP18686.1| unnamed protein product [Coffea canephora] 61 3e-07 emb|CDP21819.1| unnamed protein product [Coffea canephora] 61 3e-07 emb|CBI30799.3| unnamed protein product [Vitis vinifera] 61 3e-07 ref|XP_003614582.1| Protein SRG1 [Medicago truncatula] 61 3e-07 ref|XP_003614581.1| Protein SRG1 [Medicago truncatula] gi|355515... 61 3e-07 gb|KHN25971.1| Protein SRG1 [Glycine soja] 60 4e-07 ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 60 4e-07 >gb|KDO70212.1| hypothetical protein CISIN_1g042152mg [Citrus sinensis] Length = 256 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D +IGPAPSL+T ETPA FK ISF DYTKG LSR+L KS+++ MRI Sbjct: 202 DGEIGPAPSLITPETPALFKKISFVDYTKGFLSRKLQEKSNVDFMRI 248 >ref|XP_006437820.1| hypothetical protein CICLE_v10033531mg [Citrus clementina] gi|557540016|gb|ESR51060.1| hypothetical protein CICLE_v10033531mg [Citrus clementina] Length = 266 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D +IGPAPSL+T ETPA FK ISF DYTKG LSR+L KS+++ MRI Sbjct: 212 DGEIGPAPSLITPETPALFKKISFVDYTKGFLSRKLQEKSNVDFMRI 258 >emb|CDP14584.1| unnamed protein product [Coffea canephora] Length = 94 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D D+GPAPSL+T E PAKF + DY K + SRELDGKS++++MRI Sbjct: 48 DGDLGPAPSLITPENPAKFSRVLMVDYLKSLYSRELDGKSYIDTMRI 94 >ref|XP_011085296.1| PREDICTED: protein SRG1-like [Sesamum indicum] Length = 356 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D D+GP+PSLVT +TPAKFK I +Y KG+ SREL GKS+L+ MRI Sbjct: 310 DGDMGPSPSLVTPQTPAKFKRIGVTEYLKGLFSRELMGKSYLDLMRI 356 >ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus communis] gi|223541178|gb|EEF42734.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus communis] Length = 360 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 DA++GP PSLVT ETPA F+ I + DY KG SR+LDGKS+++ +RI Sbjct: 311 DAEVGPMPSLVTPETPASFRKIGYTDYIKGFFSRKLDGKSYVDVLRI 357 >emb|CDP21427.1| unnamed protein product [Coffea canephora] gi|661875803|emb|CDP19880.1| unnamed protein product [Coffea canephora] Length = 94 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D D+GPAPSL+T E PAKF + DY K + SRELDGKS++++MRI Sbjct: 48 DGDLGPAPSLITPENPAKFSRVLMVDYLKRLYSRELDGKSYIDTMRI 94 >ref|XP_011085301.1| PREDICTED: protein SRG1-like [Sesamum indicum] Length = 352 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D +GPA SLVT +TPAKFKTI+ A+Y KG++SREL GKS+++ MRI Sbjct: 306 DGHLGPAASLVTPQTPAKFKTIAVAEYFKGLISRELVGKSYVDLMRI 352 >ref|XP_011085299.1| PREDICTED: protein SRG1-like [Sesamum indicum] Length = 352 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D D+GPA SL+T TPAKFK I A+Y+KG SREL GKS+L++MRI Sbjct: 306 DGDMGPAQSLITPHTPAKFKRIRAAEYSKGYFSRELVGKSYLDTMRI 352 >ref|XP_010057215.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis] Length = 358 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 DA+IGPA SL+T ETPA F+ I+ A++ KG LSREL+GK++L++MR+ Sbjct: 307 DAEIGPASSLITSETPAMFRRITAAEHLKGYLSRELNGKAYLDAMRV 353 >ref|XP_010057213.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis] Length = 359 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 DA+IGPA SL+T ETPA F+ I+ A++ KG LSREL+GK++L++MR+ Sbjct: 308 DAEIGPASSLITSETPAMFRRITAAEHLKGYLSRELNGKAYLDAMRV 354 >emb|CAN70480.1| hypothetical protein VITISV_023586 [Vitis vinifera] Length = 158 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI*SMA 90 + DIGPAPSLVT +PA FK +S ADY KG+ SREL G+S+L+ ++I S A Sbjct: 105 EGDIGPAPSLVTPHSPALFKNVSVADYIKGLFSRELHGRSYLDVLKIDSEA 155 >gb|AJI44436.1| oxoglutarate-dependent dioxygenase 2 [Ocimum basilicum] Length = 354 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 +A+IGP+ SLV ETPAKFK I DY KG+ SRELDGKS+L+ MRI Sbjct: 308 EAEIGPSASLVGPETPAKFKKILSEDYFKGLFSRELDGKSYLDVMRI 354 >gb|AJI44435.1| oxoglutarate-dependent flavone 7-O-demethylase [Ocimum basilicum] Length = 372 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -2 Query: 236 DIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 +IGPA S ++ ETPAKFKTI+ A+Y KG+ S+ELDGKS+L+ MRI Sbjct: 326 NIGPAASFISGETPAKFKTITAAEYFKGLFSKELDGKSYLDLMRI 370 >emb|CDP18686.1| unnamed protein product [Coffea canephora] Length = 418 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMR 105 D D+GPAPSL+T E PA F+ IS DY+K SRELDGKS +++MR Sbjct: 367 DGDMGPAPSLITPENPAIFRRISMIDYSKAYFSRELDGKSFIDAMR 412 >emb|CDP21819.1| unnamed protein product [Coffea canephora] Length = 149 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMR 105 D D+GPAPSL+T E PA F+ IS DY K + SRELDGKS +++MR Sbjct: 98 DGDMGPAPSLITPENPAIFRRISMIDYLKALFSRELDGKSFIDAMR 143 >emb|CBI30799.3| unnamed protein product [Vitis vinifera] Length = 238 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 + DIGPAPSLVT +PA FK +S ADY KG+ SREL G+S+L+ ++I Sbjct: 161 EGDIGPAPSLVTPHSPALFKNVSVADYIKGLFSRELHGRSYLDVLKI 207 >ref|XP_003614582.1| Protein SRG1 [Medicago truncatula] Length = 181 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 236 DIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 DI PAPSLVT E+PA FKTIS ADY G LS +++GKS+L+ +RI Sbjct: 134 DISPAPSLVTPESPALFKTISIADYVNGYLSSKINGKSYLDGVRI 178 >ref|XP_003614581.1| Protein SRG1 [Medicago truncatula] gi|355515916|gb|AES97539.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula] Length = 350 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 236 DIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 DI PAPSLVT E+PA FKTIS ADY G LS +++GKS+L+ +RI Sbjct: 303 DISPAPSLVTPESPALFKTISIADYVNGYLSSKINGKSYLDGVRI 347 >gb|KHN25971.1| Protein SRG1 [Glycine soja] Length = 483 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI*SMAAVIFIQNQD 63 + +GPAPSLVT TPA FKTIS +Y +G LSREL G+S+L+SM+ IQN+D Sbjct: 429 EVKLGPAPSLVTPTTPAVFKTISVPEYYRGYLSRELRGRSYLDSMK---------IQNED 479 Query: 62 D 60 + Sbjct: 480 E 480 >ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101257141 [Solanum lycopersicum] Length = 1114 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 242 DADIGPAPSLVTLETPAKFKTISFADYTKGVLSRELDGKSHLNSMRI 102 D D+GPAPSL+T + PA+F+ I ADY KG SREL GKS+++S+RI Sbjct: 310 DGDLGPAPSLLTPQCPAEFRRIGVADYFKGYFSRELVGKSYVDSIRI 356