BLASTX nr result
ID: Forsythia21_contig00008935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00008935 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097605.1| PREDICTED: histone acetyltransferase KAT6A [... 96 1e-17 emb|CBI21473.3| unnamed protein product [Vitis vinifera] 91 3e-16 ref|XP_012853459.1| PREDICTED: apoptotic chromatin condensation ... 87 6e-15 gb|EYU24019.1| hypothetical protein MIMGU_mgv1a0022781mg, partia... 87 6e-15 ref|XP_010652843.1| PREDICTED: apoptotic chromatin condensation ... 85 2e-14 ref|XP_002276745.2| PREDICTED: apoptotic chromatin condensation ... 85 2e-14 emb|CDP20799.1| unnamed protein product [Coffea canephora] 84 3e-14 gb|KDO43726.1| hypothetical protein CISIN_1g004904mg [Citrus sin... 84 3e-14 ref|XP_006428124.1| hypothetical protein CICLE_v10025009mg [Citr... 84 3e-14 ref|XP_010261185.1| PREDICTED: apoptotic chromatin condensation ... 84 4e-14 ref|XP_004302203.1| PREDICTED: reticulocyte binding protein 2 ho... 83 6e-14 ref|XP_010099932.1| Apoptotic chromatin condensation inducer in ... 82 1e-13 ref|XP_011039562.1| PREDICTED: apoptotic chromatin condensation ... 80 4e-13 ref|XP_011021882.1| PREDICTED: apoptotic chromatin condensation ... 80 4e-13 ref|XP_011021881.1| PREDICTED: apoptotic chromatin condensation ... 80 4e-13 ref|XP_007048055.1| SAP domain-containing protein isoform 2 [The... 80 4e-13 ref|XP_007048054.1| SAP domain-containing protein isoform 1 [The... 80 4e-13 ref|XP_012466367.1| PREDICTED: apoptotic chromatin condensation ... 80 5e-13 gb|KJB84365.1| hypothetical protein B456_N021200 [Gossypium raim... 80 5e-13 ref|XP_009342064.1| PREDICTED: apoptotic chromatin condensation ... 80 7e-13 >ref|XP_011097605.1| PREDICTED: histone acetyltransferase KAT6A [Sesamum indicum] Length = 898 Score = 95.5 bits (236), Expect = 1e-17 Identities = 47/57 (82%), Positives = 49/57 (85%) Frame = -1 Query: 173 EHPLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 + PLP REQ LP RER NLPPPPPL EKVDPPIVTLDDLF+KTKATPRIYYLPLS Sbjct: 723 KEPLP---REQHLPARERLNLPPPPPLPEKVDPPIVTLDDLFRKTKATPRIYYLPLS 776 >emb|CBI21473.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 90.9 bits (224), Expect = 3e-16 Identities = 43/55 (78%), Positives = 46/55 (83%) Frame = -1 Query: 167 PLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P A + QP P ++R LPPPPPL EKVDPPIVTLDDLFQKTKATPRIYYLPLS Sbjct: 342 PSPPAKQPQPPPRKQRLPLPPPPPLPEKVDPPIVTLDDLFQKTKATPRIYYLPLS 396 >ref|XP_012853459.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus [Erythranthe guttatus] Length = 739 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P ARE+ R+R NLPPPPPLSEKVDPPIVTLDDLF+KTKA PRIYYLPLS Sbjct: 671 PPLARERLQLSRDRINLPPPPPLSEKVDPPIVTLDDLFRKTKAIPRIYYLPLS 723 >gb|EYU24019.1| hypothetical protein MIMGU_mgv1a0022781mg, partial [Erythranthe guttata] Length = 278 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P ARE+ R+R NLPPPPPLSEKVDPPIVTLDDLF+KTKA PRIYYLPLS Sbjct: 210 PPLARERLQLSRDRINLPPPPPLSEKVDPPIVTLDDLFRKTKAIPRIYYLPLS 262 >ref|XP_010652843.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus isoform X2 [Vitis vinifera] Length = 662 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/53 (77%), Positives = 41/53 (77%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P RER LPPPPPL EKVDPPIVTLDDLFQKTKATPRIYYLPLS Sbjct: 593 PPPPLSNPPQTRERLPLPPPPPLPEKVDPPIVTLDDLFQKTKATPRIYYLPLS 645 >ref|XP_002276745.2| PREDICTED: apoptotic chromatin condensation inducer in the nucleus isoform X1 [Vitis vinifera] Length = 691 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/53 (77%), Positives = 41/53 (77%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P RER LPPPPPL EKVDPPIVTLDDLFQKTKATPRIYYLPLS Sbjct: 593 PPPPLSNPPQTRERLPLPPPPPLPEKVDPPIVTLDDLFQKTKATPRIYYLPLS 645 >emb|CDP20799.1| unnamed protein product [Coffea canephora] Length = 725 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPP-LSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P +RE P V+ER LPPPPP L EK+DPPI+TLDDLF+KTKATPRIYYLPLS Sbjct: 655 PPPSREHPASVKERLTLPPPPPPLPEKIDPPILTLDDLFRKTKATPRIYYLPLS 708 >gb|KDO43726.1| hypothetical protein CISIN_1g004904mg [Citrus sinensis] Length = 724 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 134 PVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P RER LPPPPPL EK+DPPIVTLDDLF+KTKATPRIYYLPLS Sbjct: 664 PARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLS 707 >ref|XP_006428124.1| hypothetical protein CICLE_v10025009mg [Citrus clementina] gi|568819502|ref|XP_006464290.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like [Citrus sinensis] gi|557530114|gb|ESR41364.1| hypothetical protein CICLE_v10025009mg [Citrus clementina] Length = 724 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 134 PVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P RER LPPPPPL EK+DPPIVTLDDLF+KTKATPRIYYLPLS Sbjct: 664 PARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLS 707 >ref|XP_010261185.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus [Nelumbo nucifera] Length = 658 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/55 (72%), Positives = 45/55 (81%) Frame = -1 Query: 167 PLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P + P+PVRER LPPPPPL +K DPPIVTLDDLF+KT+ATPRIYYLPLS Sbjct: 590 PPPTVSDPTPIPVRER--LPPPPPLPKKPDPPIVTLDDLFRKTRATPRIYYLPLS 642 >ref|XP_004302203.1| PREDICTED: reticulocyte binding protein 2 homolog b [Fragaria vesca subsp. vesca] Length = 739 Score = 83.2 bits (204), Expect = 6e-14 Identities = 40/54 (74%), Positives = 43/54 (79%) Frame = -1 Query: 164 LPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 LP LP +ER LPPPPPL EKVDPP+VTLDDLF+KTKATPRIYYLPLS Sbjct: 669 LPPPPPLSSLPPKERLPLPPPPPLLEKVDPPLVTLDDLFRKTKATPRIYYLPLS 722 >ref|XP_010099932.1| Apoptotic chromatin condensation inducer in the nucleus [Morus notabilis] gi|587892274|gb|EXB80861.1| Apoptotic chromatin condensation inducer in the nucleus [Morus notabilis] Length = 713 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P RER LPPPPPL EK+DPPIVTLDDLF+KTKATPRIYYLPLS Sbjct: 647 PPPPLSNPPQARERLPLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLS 699 >ref|XP_011039562.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like [Populus euphratica] Length = 779 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/55 (72%), Positives = 42/55 (76%) Frame = -1 Query: 167 PLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 PLP A P RER +LPPPPPL EK DPPIVTLDDLF+KTK PRIYYLPLS Sbjct: 626 PLPPALSNPP-HARERVDLPPPPPLPEKHDPPIVTLDDLFRKTKTAPRIYYLPLS 679 >ref|XP_011021882.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like isoform X2 [Populus euphratica] Length = 692 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/55 (72%), Positives = 42/55 (76%) Frame = -1 Query: 167 PLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 PLP A P RER +LPPPPPL EK DPPIVTLDDLF+KTK PRIYYLPLS Sbjct: 622 PLPPALSNPP-HARERVDLPPPPPLPEKHDPPIVTLDDLFRKTKTAPRIYYLPLS 675 >ref|XP_011021881.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like isoform X1 [Populus euphratica] Length = 775 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/55 (72%), Positives = 42/55 (76%) Frame = -1 Query: 167 PLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 PLP A P RER +LPPPPPL EK DPPIVTLDDLF+KTK PRIYYLPLS Sbjct: 622 PLPPALSNPP-HARERVDLPPPPPLPEKHDPPIVTLDDLFRKTKTAPRIYYLPLS 675 >ref|XP_007048055.1| SAP domain-containing protein isoform 2 [Theobroma cacao] gi|508700316|gb|EOX92212.1| SAP domain-containing protein isoform 2 [Theobroma cacao] Length = 740 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P PVRER LPPPPP EK+DPPIVTLDDLF+KTKATPRIYYLPLS Sbjct: 673 PPPPLSNPPPVRERLPLPPPPP--EKLDPPIVTLDDLFRKTKATPRIYYLPLS 723 >ref|XP_007048054.1| SAP domain-containing protein isoform 1 [Theobroma cacao] gi|508700315|gb|EOX92211.1| SAP domain-containing protein isoform 1 [Theobroma cacao] Length = 780 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = -1 Query: 161 PAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 P P PVRER LPPPPP EK+DPPIVTLDDLF+KTKATPRIYYLPLS Sbjct: 673 PPPPLSNPPPVRERLPLPPPPP--EKLDPPIVTLDDLFRKTKATPRIYYLPLS 723 >ref|XP_012466367.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like [Gossypium raimondii] Length = 763 Score = 80.1 bits (196), Expect = 5e-13 Identities = 43/61 (70%), Positives = 46/61 (75%), Gaps = 4/61 (6%) Frame = -1 Query: 173 EHPLPAAAREQPL----PVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPL 6 +HP P+A PL PVRER LPPPP +EKVDPPIVTLDDLF KTKA PRIYYLPL Sbjct: 690 QHPPPSALPPPPLSNPPPVRERLPLPPPP--AEKVDPPIVTLDDLFWKTKAIPRIYYLPL 747 Query: 5 S 3 S Sbjct: 748 S 748 >gb|KJB84365.1| hypothetical protein B456_N021200 [Gossypium raimondii] Length = 718 Score = 80.1 bits (196), Expect = 5e-13 Identities = 43/61 (70%), Positives = 46/61 (75%), Gaps = 4/61 (6%) Frame = -1 Query: 173 EHPLPAAAREQPL----PVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPL 6 +HP P+A PL PVRER LPPPP +EKVDPPIVTLDDLF KTKA PRIYYLPL Sbjct: 645 QHPPPSALPPPPLSNPPPVRERLPLPPPP--AEKVDPPIVTLDDLFWKTKAIPRIYYLPL 702 Query: 5 S 3 S Sbjct: 703 S 703 >ref|XP_009342064.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus [Pyrus x bretschneideri] Length = 744 Score = 79.7 bits (195), Expect = 7e-13 Identities = 40/55 (72%), Positives = 43/55 (78%) Frame = -1 Query: 167 PLPAAAREQPLPVRERHNLPPPPPLSEKVDPPIVTLDDLFQKTKATPRIYYLPLS 3 PLP A P RER LPPPPPL EK+D PIVTLDDLF+KTK+TPRIYYLPLS Sbjct: 677 PLPTAP-----PARERLPLPPPPPLPEKLDLPIVTLDDLFRKTKSTPRIYYLPLS 726