BLASTX nr result
ID: Forsythia21_contig00007440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00007440 (548 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085887.1| PREDICTED: uncharacterized protein LOC105167... 60 6e-07 >ref|XP_011085887.1| PREDICTED: uncharacterized protein LOC105167768 [Sesamum indicum] Length = 224 Score = 60.1 bits (144), Expect = 6e-07 Identities = 37/81 (45%), Positives = 47/81 (58%) Frame = +3 Query: 306 DTTEQTNGVLIEGAGDSEESGFHTKNKKTYNQELGEVTLYTIFINLINAIFLRSPNSRYA 485 D + G++ EG G+SE+ TK +VTLYTIF LI A F P+S Sbjct: 5 DANKPNGGLVAEGVGESEQG---TK----------DVTLYTIFSRLIAAAFFPDPSS--- 48 Query: 486 SAPLLQRIKTSLSENIPLLRD 548 S P+LQR+K SLS N+PLLRD Sbjct: 49 SGPMLQRVKASLSVNVPLLRD 69