BLASTX nr result
ID: Forsythia21_contig00006806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006806 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072730.1| PREDICTED: ATP synthase subunit epsilon, mit... 68 3e-09 ref|XP_012856764.1| PREDICTED: ATP synthase subunit epsilon, mit... 67 4e-09 ref|XP_006379402.1| hypothetical protein POPTR_0008s00930g [Popu... 67 4e-09 gb|EPS71967.1| hypothetical protein M569_02792 [Genlisea aurea] 67 4e-09 emb|CDP06893.1| unnamed protein product [Coffea canephora] 67 5e-09 ref|XP_010111480.1| ATP synthase subunit epsilon [Morus notabili... 66 8e-09 sp|Q06450.2|ATP5E_IPOBA RecName: Full=ATP synthase subunit epsil... 66 8e-09 ref|XP_012078426.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 8e-09 ref|XP_012489332.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 8e-09 gb|KHG00299.1| hypothetical protein F383_19415 [Gossypium arboreum] 66 8e-09 ref|XP_008462225.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 8e-09 ref|XP_008229364.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 8e-09 gb|KDP32567.1| hypothetical protein JCGZ_13117 [Jatropha curcas] 66 8e-09 ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, p... 66 8e-09 ref|XP_007048283.1| ATP synthase epsilon chain, mitochondrial is... 66 8e-09 ref|XP_007048282.1| ATP synthase epsilon chain, mitochondrial is... 66 8e-09 ref|XP_007215223.1| hypothetical protein PRUPE_ppa014403mg [Prun... 66 8e-09 ref|XP_009763216.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 1e-08 ref|XP_009587132.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 1e-08 ref|XP_009608469.1| PREDICTED: ATP synthase subunit epsilon, mit... 66 1e-08 >ref|XP_011072730.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Sesamum indicum] Length = 69 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITY+NLCANLVRQCL Sbjct: 1 MASNAAVPFWRAAGMTYITYTNLCANLVRQCL 32 >ref|XP_012856764.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Erythranthe guttatus] gi|604301640|gb|EYU21226.1| hypothetical protein MIMGU_mgv1a017528mg [Erythranthe guttata] Length = 69 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MAS+AAVPFWR+AGMTYITYSNLCANLVRQCL Sbjct: 1 MASSAAVPFWRSAGMTYITYSNLCANLVRQCL 32 >ref|XP_006379402.1| hypothetical protein POPTR_0008s00930g [Populus trichocarpa] gi|550332101|gb|ERP57199.1| hypothetical protein POPTR_0008s00930g [Populus trichocarpa] Length = 130 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -2 Query: 127 RVER*RKEAEMASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 R E R+ MASNAA PFWR AGMTYITYSN+CANLVR CL Sbjct: 25 RQEEERRVIPMASNAAAPFWRAAGMTYITYSNICANLVRNCL 66 >gb|EPS71967.1| hypothetical protein M569_02792 [Genlisea aurea] Length = 70 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAA PFWR AGMTYITYSNLCANLVRQCL Sbjct: 1 MASNAAAPFWRAAGMTYITYSNLCANLVRQCL 32 >emb|CDP06893.1| unnamed protein product [Coffea canephora] Length = 70 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSNLCANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNLCANLVRNCL 32 >ref|XP_010111480.1| ATP synthase subunit epsilon [Morus notabilis] gi|587944531|gb|EXC31003.1| ATP synthase subunit epsilon [Morus notabilis] Length = 287 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >sp|Q06450.2|ATP5E_IPOBA RecName: Full=ATP synthase subunit epsilon, mitochondrial; Short=ATPase subunit epsilon [Ipomoea batatas] gi|303625|dbj|BAA03527.1| F1-ATPase epsilon-subunit [Ipomoea batatas] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSNLCAN+VR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNLCANMVRNCL 32 >ref|XP_012078426.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Jatropha curcas] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_012489332.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Gossypium raimondii] gi|763773325|gb|KJB40448.1| hypothetical protein B456_007G063900 [Gossypium raimondii] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >gb|KHG00299.1| hypothetical protein F383_19415 [Gossypium arboreum] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_008462225.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Cucumis melo] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_008229364.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial [Prunus mume] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >gb|KDP32567.1| hypothetical protein JCGZ_13117 [Jatropha curcas] Length = 105 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_002517228.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] gi|223543599|gb|EEF45128.1| ATP synthase epsilon chain, mitochondrial, putative [Ricinus communis] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_007048283.1| ATP synthase epsilon chain, mitochondrial isoform 2 [Theobroma cacao] gi|508700544|gb|EOX92440.1| ATP synthase epsilon chain, mitochondrial isoform 2 [Theobroma cacao] Length = 64 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_007048282.1| ATP synthase epsilon chain, mitochondrial isoform 1 [Theobroma cacao] gi|508700543|gb|EOX92439.1| ATP synthase epsilon chain, mitochondrial isoform 1 [Theobroma cacao] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_007215223.1| hypothetical protein PRUPE_ppa014403mg [Prunus persica] gi|462411373|gb|EMJ16422.1| hypothetical protein PRUPE_ppa014403mg [Prunus persica] Length = 70 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAAVPFWR AGMTYITYSN+CANLVR CL Sbjct: 1 MASNAAVPFWRAAGMTYITYSNICANLVRNCL 32 >ref|XP_009763216.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Nicotiana sylvestris] Length = 70 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAA PFWR+AGMTYITYSNLCANLVR CL Sbjct: 1 MASNAAAPFWRSAGMTYITYSNLCANLVRNCL 32 >ref|XP_009587132.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Nicotiana tomentosiformis] gi|698539137|ref|XP_009765352.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Nicotiana sylvestris] Length = 70 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAA PFWR+AGMTYITYSNLCANLVR CL Sbjct: 1 MASNAAAPFWRSAGMTYITYSNLCANLVRNCL 32 >ref|XP_009608469.1| PREDICTED: ATP synthase subunit epsilon, mitochondrial-like [Nicotiana tomentosiformis] Length = 70 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 MASNAAVPFWRTAGMTYITYSNLCANLVRQCL 2 MASNAA PFWR+AGMTYITYSNLCANLVR CL Sbjct: 1 MASNAAAPFWRSAGMTYITYSNLCANLVRNCL 32