BLASTX nr result
ID: Forsythia21_contig00006766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006766 (614 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199960.1| hypothetical protein PRUPE_ppa026313mg, part... 51 3e-10 >ref|XP_007199960.1| hypothetical protein PRUPE_ppa026313mg, partial [Prunus persica] gi|462395360|gb|EMJ01159.1| hypothetical protein PRUPE_ppa026313mg, partial [Prunus persica] Length = 205 Score = 50.8 bits (120), Expect(2) = 3e-10 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -2 Query: 118 LLWLAAIGLKNVCLYDNEGVLKRSEQAITEILKSEKRFK 2 L WL AIG+K VCLYD EGVLK+S++AI L++ FK Sbjct: 77 LQWLEAIGVKRVCLYDTEGVLKKSKEAILNKLRNASEFK 115 Score = 40.8 bits (94), Expect(2) = 3e-10 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -3 Query: 222 GNYGVHLFWRIMHLILSIWYFFLWLVY 142 GN G+ L W I+HL +SIWYF L L Y Sbjct: 18 GNLGLLLLWHILHLFVSIWYFLLGLAY 44