BLASTX nr result
ID: Forsythia21_contig00006662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006662 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012474814.1| PREDICTED: B2 protein-like [Gossypium raimon... 59 1e-06 ref|XP_011082302.1| PREDICTED: B2 protein [Sesamum indicum] 59 1e-06 gb|KHF97500.1| Uncharacterized protein F383_14816 [Gossypium arb... 59 1e-06 ref|XP_010267585.1| PREDICTED: B2 protein [Nelumbo nucifera] 58 3e-06 dbj|BAB33035.1| CPRD48 [Vigna unguiculata] 57 6e-06 gb|KHM99883.1| B2 protein [Glycine soja] 57 6e-06 ref|XP_007160187.1| hypothetical protein PHAVU_002G300300g [Phas... 57 6e-06 ref|NP_001239779.1| uncharacterized protein LOC100808989 [Glycin... 57 6e-06 ref|XP_006584575.1| PREDICTED: uncharacterized protein LOC100796... 56 8e-06 ref|NP_001242010.1| uncharacterized protein LOC100796450 [Glycin... 56 8e-06 >ref|XP_012474814.1| PREDICTED: B2 protein-like [Gossypium raimondii] gi|763756852|gb|KJB24183.1| hypothetical protein B456_004G131900 [Gossypium raimondii] Length = 313 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP 238 HYDGPKFRLELNVPEA+SLLDIFAE DP Sbjct: 286 HYDGPKFRLELNVPEALSLLDIFAEQDP 313 >ref|XP_011082302.1| PREDICTED: B2 protein [Sesamum indicum] Length = 334 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP 238 HYDGPKFRLELN+PEA+SLLDIFAEN+P Sbjct: 307 HYDGPKFRLELNIPEALSLLDIFAENNP 334 >gb|KHF97500.1| Uncharacterized protein F383_14816 [Gossypium arboreum] Length = 263 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP 238 HYDGPKFRLELNVPEA+SLLDIFAE DP Sbjct: 236 HYDGPKFRLELNVPEALSLLDIFAEQDP 263 >ref|XP_010267585.1| PREDICTED: B2 protein [Nelumbo nucifera] Length = 338 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP 238 HYDGPKFRLELN+PEA++LLDIFAEN+P Sbjct: 311 HYDGPKFRLELNIPEALALLDIFAENNP 338 >dbj|BAB33035.1| CPRD48 [Vigna unguiculata] Length = 71 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP*N 232 HYDGPKFRLELNVPEA+SLLDIFAE D N Sbjct: 34 HYDGPKFRLELNVPEALSLLDIFAEQDTFN 63 >gb|KHM99883.1| B2 protein [Glycine soja] Length = 330 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP*N 232 HYDGPKFRLELNVPEA+SLLDIFAE D N Sbjct: 293 HYDGPKFRLELNVPEALSLLDIFAEQDTFN 322 >ref|XP_007160187.1| hypothetical protein PHAVU_002G300300g [Phaseolus vulgaris] gi|561033602|gb|ESW32181.1| hypothetical protein PHAVU_002G300300g [Phaseolus vulgaris] Length = 333 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP*N 232 HYDGPKFRLELNVPEA+SLLDIFAE D N Sbjct: 296 HYDGPKFRLELNVPEALSLLDIFAEQDTFN 325 >ref|NP_001239779.1| uncharacterized protein LOC100808989 [Glycine max] gi|255637142|gb|ACU18902.1| unknown [Glycine max] Length = 330 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAENDP*N 232 HYDGPKFRLELNVPEA+SLLDIFAE D N Sbjct: 293 HYDGPKFRLELNVPEALSLLDIFAEQDTFN 322 >ref|XP_006584575.1| PREDICTED: uncharacterized protein LOC100796450 isoform X1 [Glycine max] gi|734363664|gb|KHN16725.1| B2 protein [Glycine soja] Length = 327 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAEND 241 HYDGPKFRLELNVPEA+SLLDIFAE D Sbjct: 290 HYDGPKFRLELNVPEALSLLDIFAEQD 316 >ref|NP_001242010.1| uncharacterized protein LOC100796450 [Glycine max] gi|255634801|gb|ACU17761.1| unknown [Glycine max] Length = 328 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 321 HYDGPKFRLELNVPEAISLLDIFAEND 241 HYDGPKFRLELNVPEA+SLLDIFAE D Sbjct: 291 HYDGPKFRLELNVPEALSLLDIFAEQD 317