BLASTX nr result
ID: Forsythia21_contig00006446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006446 (944 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012845095.1| PREDICTED: THO complex subunit 4D [Erythrant... 60 3e-06 >ref|XP_012845095.1| PREDICTED: THO complex subunit 4D [Erythranthe guttatus] gi|604319738|gb|EYU30902.1| hypothetical protein MIMGU_mgv1a011416mg [Erythranthe guttata] Length = 282 Score = 59.7 bits (143), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 93 QSFRRTKNLPWQNGLFEDGLRAAGLSGLANG 1 +SFRRTKNLPWQNGLFEDGL+AAGLSGL G Sbjct: 70 KSFRRTKNLPWQNGLFEDGLKAAGLSGLDAG 100