BLASTX nr result
ID: Forsythia21_contig00006195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006195 (342 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010680551.1| PREDICTED: CMP-sialic acid transporter 5 [Be... 62 1e-07 ref|XP_010519554.1| PREDICTED: CMP-sialic acid transporter 5 [Ta... 62 2e-07 ref|XP_009802683.1| PREDICTED: CMP-sialic acid transporter 5 [Ni... 61 3e-07 ref|XP_009594352.1| PREDICTED: CMP-sialic acid transporter 5 [Ni... 61 3e-07 ref|XP_011097577.1| PREDICTED: CMP-sialic acid transporter 5 [Se... 61 3e-07 ref|XP_009150575.1| PREDICTED: CMP-sialic acid transporter 5 [Br... 60 6e-07 emb|CDY08830.1| BnaA06g23940D [Brassica napus] 60 6e-07 emb|CDY18688.1| BnaA09g07070D [Brassica napus] 60 6e-07 ref|XP_012853564.1| PREDICTED: CMP-sialic acid transporter 5 [Er... 60 6e-07 ref|XP_006394087.1| hypothetical protein EUTSA_v10004589mg [Eutr... 60 6e-07 gb|KFK28185.1| hypothetical protein AALP_AA8G483300 [Arabis alpina] 60 7e-07 emb|CDX81266.1| BnaC09g06770D [Brassica napus] 59 1e-06 emb|CDY14528.1| BnaC03g49310D [Brassica napus] 59 1e-06 emb|CDP01453.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_006280706.1| hypothetical protein CARUB_v10026670mg, part... 59 1e-06 ref|XP_012489286.1| PREDICTED: CMP-sialic acid transporter 5-lik... 59 2e-06 gb|KHG08794.1| hypothetical protein F383_15436 [Gossypium arboreum] 59 2e-06 ref|XP_007047955.1| Nucleotide-sugar transporter family protein ... 59 2e-06 gb|KHN06582.1| CMP-sialic acid transporter 5 [Glycine soja] 58 2e-06 ref|XP_010484301.1| PREDICTED: CMP-sialic acid transporter 5 iso... 58 3e-06 >ref|XP_010680551.1| PREDICTED: CMP-sialic acid transporter 5 [Beta vulgaris subsp. vulgaris] gi|870857229|gb|KMT08789.1| hypothetical protein BVRB_6g135130 [Beta vulgaris subsp. vulgaris] Length = 334 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F FDGKPPSPYCLVA PLVI+S SIYQKYPY Sbjct: 297 FIFDGKPPSPYCLVALPLVITSISIYQKYPY 327 >ref|XP_010519554.1| PREDICTED: CMP-sialic acid transporter 5 [Tarenaya hassleriana] Length = 325 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F F+GKPPSPYCLVA PLVISS S+YQKYPY Sbjct: 287 FAFEGKPPSPYCLVALPLVISSISLYQKYPY 317 >ref|XP_009802683.1| PREDICTED: CMP-sialic acid transporter 5 [Nicotiana sylvestris] Length = 334 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F FDGKPPSPYCLVA PLV++S SIYQKYPY Sbjct: 297 FIFDGKPPSPYCLVALPLVMTSISIYQKYPY 327 >ref|XP_009594352.1| PREDICTED: CMP-sialic acid transporter 5 [Nicotiana tomentosiformis] Length = 334 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F FDGKPPSPYCLVA PLV++S SIYQKYPY Sbjct: 297 FIFDGKPPSPYCLVALPLVMTSISIYQKYPY 327 >ref|XP_011097577.1| PREDICTED: CMP-sialic acid transporter 5 [Sesamum indicum] Length = 331 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 + FDGKPPSPYCLVA PLV++S SIYQKYPY Sbjct: 294 YIFDGKPPSPYCLVALPLVVTSISIYQKYPY 324 >ref|XP_009150575.1| PREDICTED: CMP-sialic acid transporter 5 [Brassica rapa] Length = 326 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLVISS S+YQKYPYL Sbjct: 288 FAFEGKPPSSYCLVALPLVISSISLYQKYPYL 319 >emb|CDY08830.1| BnaA06g23940D [Brassica napus] Length = 429 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLVISS S+YQKYPYL Sbjct: 285 FAFEGKPPSSYCLVALPLVISSISLYQKYPYL 316 >emb|CDY18688.1| BnaA09g07070D [Brassica napus] Length = 326 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLVISS S+YQKYPYL Sbjct: 288 FAFEGKPPSSYCLVALPLVISSISLYQKYPYL 319 >ref|XP_012853564.1| PREDICTED: CMP-sialic acid transporter 5 [Erythranthe guttatus] gi|604304740|gb|EYU23991.1| hypothetical protein MIMGU_mgv1a009799mg [Erythranthe guttata] Length = 331 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 + FDGK PSPYCLVA PLV++STSIYQKYPY Sbjct: 294 YIFDGKAPSPYCLVALPLVVTSTSIYQKYPY 324 >ref|XP_006394087.1| hypothetical protein EUTSA_v10004589mg [Eutrema salsugineum] gi|557090726|gb|ESQ31373.1| hypothetical protein EUTSA_v10004589mg [Eutrema salsugineum] Length = 325 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLVISS S+YQKYPYL Sbjct: 287 FAFEGKPPSSYCLVALPLVISSISLYQKYPYL 318 >gb|KFK28185.1| hypothetical protein AALP_AA8G483300 [Arabis alpina] Length = 322 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLVISS S+YQKYPYL Sbjct: 284 FAFEGKPPSSYCLVALPLVISSISMYQKYPYL 315 >emb|CDX81266.1| BnaC09g06770D [Brassica napus] Length = 326 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLVISS S+YQKYPY+ Sbjct: 288 FAFEGKPPSSYCLVALPLVISSISLYQKYPYM 319 >emb|CDY14528.1| BnaC03g49310D [Brassica napus] Length = 326 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLV+ PLVISS S+YQKYPYL Sbjct: 288 FAFEGKPPSSYCLVSLPLVISSISLYQKYPYL 319 >emb|CDP01453.1| unnamed protein product [Coffea canephora] Length = 77 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F FDGKPPS YCLVA PLVI+S S+YQKYPY Sbjct: 40 FVFDGKPPSLYCLVALPLVITSVSVYQKYPY 70 >ref|XP_006280706.1| hypothetical protein CARUB_v10026670mg, partial [Capsella rubella] gi|482549410|gb|EOA13604.1| hypothetical protein CARUB_v10026670mg, partial [Capsella rubella] Length = 357 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPPS YCLVA PLV+SS S+YQKYPYL Sbjct: 319 FAFEGKPPSSYCLVALPLVMSSISLYQKYPYL 350 >ref|XP_012489286.1| PREDICTED: CMP-sialic acid transporter 5-like [Gossypium raimondii] gi|763773251|gb|KJB40374.1| hypothetical protein B456_007G060800 [Gossypium raimondii] Length = 327 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F F+GKPPS YCLVA PLVISS SIYQKYPY Sbjct: 290 FLFEGKPPSVYCLVALPLVISSISIYQKYPY 320 >gb|KHG08794.1| hypothetical protein F383_15436 [Gossypium arboreum] Length = 327 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F F+GKPPS YCLVA PLVISS SIYQKYPY Sbjct: 290 FLFEGKPPSVYCLVALPLVISSISIYQKYPY 320 >ref|XP_007047955.1| Nucleotide-sugar transporter family protein [Theobroma cacao] gi|508700216|gb|EOX92112.1| Nucleotide-sugar transporter family protein [Theobroma cacao] Length = 312 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F F+GKPPS YCLVA PLVISS SIYQKYPY Sbjct: 275 FLFEGKPPSVYCLVALPLVISSISIYQKYPY 305 >gb|KHN06582.1| CMP-sialic acid transporter 5 [Glycine soja] Length = 313 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPY 250 F FDGKPPS YCLVA PLV++S SIYQKYPY Sbjct: 276 FIFDGKPPSLYCLVALPLVVTSISIYQKYPY 306 >ref|XP_010484301.1| PREDICTED: CMP-sialic acid transporter 5 isoform X2 [Camelina sativa] Length = 265 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 342 FTFDGKPPSPYCLVAFPLVISSTSIYQKYPYL 247 F F+GKPP+ YCLVA PLV+SS S+YQKYPYL Sbjct: 224 FAFEGKPPTSYCLVALPLVMSSISLYQKYPYL 255